DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and KCNK7

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_203133.1 Gene:KCNK7 / 10089 HGNCID:6282 Length:307 Species:Homo sapiens


Alignment Length:293 Identity:65/293 - (22%)
Similarity:123/293 - (41%) Gaps:70/293 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NRWILLLIFYISYLMFGAAIYYHIEHGEEKISRAEQRKAQIA---------INEYLLEELGDKNT 59
            :|:.||::.::..|..||.::..:| |........:.:|::|         :....||||.....
Human     8 SRYGLLVVAHLLALGLGAVVFQALE-GPPACRLQAELRAELAAFQAEHRACLPPGALEELLGTAL 71

  Fly    60 TTQDEILQRISDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIA 124
            .||...:..:.:            .....||....|..||.::.:|.|||:::|.:..|:...:.
Human    72 ATQAHGVSTLGN------------SSEGRTWDLPSALLFAASILTTTGYGHMAPLSPGGKAFCMV 124

  Fly   125 YSVIGIPVNGILFAGLGEYF------GRTFEAIYRRYKKYKMSTDMHYVPPQLGLITTVVIALIP 183
            |:.:|:|.:..|.|.|....      .|.:.|::     :::|      |.:..|:..|.:.|:.
Human   125 YAALGLPASLALVATLRHCLLPVLSRPRAWVAVH-----WQLS------PARAALLQAVALGLLV 178

  Fly   184 GIALFLLLPSWVFTYFENW----PYSI--SLYYSYVTTTTIGFGDYVPTFGAN-QPKEFGGWFVV 241
            . :.|:|||:.|.     |    ..|:  ::|:.:.:.:|||..|.:|..|.: .|       |:
Human   179 A-SSFVLLPALVL-----WGLQGDCSLLGAVYFCFSSLSTIGLEDLLPGRGRSLHP-------VI 230

  Fly   242 YQIFVIVWFIFSLGYLVMIMTFITRGLQSKKLA 274
            |.:..:.    .||||::       ||.:..||
Human   231 YHLGQLA----LLGYLLL-------GLLAMLLA 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 16/53 (30%)
Ion_trans_2 185..269 CDD:285168 22/90 (24%)
KCNK7NP_203133.1 Ion_trans_2 <90..140 CDD:285168 15/49 (31%)
Ion_trans_2 182..>220 CDD:285168 12/42 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155182
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.