DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and kcnk15

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:XP_004918713.1 Gene:kcnk15 / 100492337 XenbaseID:XB-GENE-6065312 Length:411 Species:Xenopus tropicalis


Alignment Length:310 Identity:82/310 - (26%)
Similarity:147/310 - (47%) Gaps:68/310 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RWILLLIFYISYLMFGAAIYYHIEHGEEKISR---AEQRKAQIAINEYLLEELGDKNTTTQDEIL 66
            |.:.|::...|||:.|||::..:| .|.:|||   .|:::..:. |:|   ...|::....:.::
 Frog    19 RTLSLILCMFSYLLVGAAVFDALE-SESEISRKRILEEKRLNLR-NKY---GFSDEDYREIERVV 78

  Fly    67 QRISDYCDKPVTLPPTYDDTPY----TWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSV 127
            |:                ..|:    .|.|..:|:||.||.:|:|||:.:|.|.||::..:.|:|
 Frog    79 QQ----------------SEPHRAGKQWKFAGSFYFAITVITTIGYGHAAPGTDAGKVFCMFYAV 127

  Fly   128 IGIPVNGILFAGLGEYFGRTFEAIYR------RYKKYKMSTDMHYVPPQLGLITTVVIALIPGIA 186
            :|||:..::|..|||........:.:      |.:|.::|.:...:...|..|.|:.|    |.|
 Frog   128 LGIPLTLVMFQSLGERMNTFVRFLLKKLKRCFRLRKTEVSMENMVLVGFLSCIGTLGI----GAA 188

  Fly   187 LFLLLPSWVFTYFENWPYSISLYYSYVTTTTIGFGDYVPTFGANQPKE----------FGGWFVV 241
                    .|:|||.|.:..|.||.::|.|||||||:|    |.|..|          |...:::
 Frog   189 --------AFSYFEGWTFFHSYYYCFITLTTIGFGDFV----ALQKNEALQKKPPYVAFSFMYIL 241

  Fly   242 YQIFVIVWFIFSLGYLVMIMTFITRGLQSKKLAYLEQQLSSNLKATQNRI 291
            ..:.||..|:     .::::.|:|...:.::   .:.:..::|:..||.|
 Frog   242 VGLTVIGAFL-----NLVVLRFLTMNSEDER---RDAEERASLRRAQNNI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 24/53 (45%)
Ion_trans_2 185..269 CDD:285168 27/93 (29%)
kcnk15XP_004918713.1 Ion_trans_2 <89..144 CDD:369572 24/54 (44%)
Ion_trans_2 <192..255 CDD:369572 23/71 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.