DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and kcnk5

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:XP_017945689.1 Gene:kcnk5 / 100489489 XenbaseID:XB-GENE-979847 Length:478 Species:Xenopus tropicalis


Alignment Length:348 Identity:99/348 - (28%)
Similarity:155/348 - (44%) Gaps:69/348 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NRWILLLIFYISYLMFGAAIYYHIEHGEEKISRA--EQRKAQIAINEYLLEELGDKNTTTQD--E 64
            :|..:|....|.||..||||:..:|....|.:..  ::.|.:|......|        |.:|  |
 Frog     3 DRGPILTSAVIFYLSIGAAIFQVLEEPNWKAATQLYKENKVKILAKHSCL--------TPRDLEE 59

  Fly    65 ILQRISDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIG 129
            ||:.:|....:.||:  |.:.|...|.:.:|..||.||.:|:|||||:|.|.|||:..|.|.:.|
 Frog    60 ILETVSSAAGQGVTI--TGNTTFNNWNWPNAVIFAATVITTIGYGNIAPKTSAGRLFCIFYGLFG 122

  Fly   130 IPVNGILFAGLGEYFGRTFEAIYRRYKKYKMSTDMHYVPPQLGLITTVVIALIPGIALFLLLPSW 194
            :|:.....:.||::||       .|.|:.........|..:...||...|.:|.|:.:.|::|.:
 Frog   123 VPLCLTWISALGKFFG-------GRAKRLGQFLTKRGVTLRKAQITCTAIFIIWGVLVHLVIPPF 180

  Fly   195 VFTYFENWPYSISLYYSYVTTTTIGFGDYVPTFGANQPKEFGGWFVVYQIFVIVWFIFSLGYLVM 259
            :|...|.|.|...||:|::|.|||||||||.  |.| ||.  .:.|:|:.||.:|....|.:|.:
 Frog   181 IFMKTEGWDYIEGLYFSFITITTIGFGDYVA--GVN-PKV--NYNVLYRYFVEIWIYLGLAWLSL 240

  Fly   260 IMTFITRGLQSKKLAYLEQQLSSNLKATQNRIWSGVTKDVGYLRRMLNELYILKVKFCRKGNRKK 324
            .:.:       |...:||..     ||.:.|                               ||:
 Frog   241 FVNW-------KVSMFLEVH-----KAIKKR-------------------------------RKR 262

  Fly   325 PKNKAKTEQKKKSSRYIAYTLPR 347
            .|...:.:.:.|.::.:..|.|:
 Frog   263 RKESFENDPQMKQTKAVPMTNPK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 23/53 (43%)
Ion_trans_2 185..269 CDD:285168 30/83 (36%)
kcnk5XP_017945689.1 Ion_trans_2 <82..137 CDD:369572 23/54 (43%)
Ion_trans_2 165..243 CDD:369572 33/82 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9761
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.