DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and kcnk6

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_001120420.1 Gene:kcnk6 / 100145504 XenbaseID:XB-GENE-958681 Length:308 Species:Xenopus tropicalis


Alignment Length:319 Identity:85/319 - (26%)
Similarity:142/319 - (44%) Gaps:66/319 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WILLLIF---YISYLMFGAAIYYHIEHGEEKISRAEQRKAQIAINEYLLEELGDKNTTTQDEILQ 67
            |:||.:.   |:.||:.||.:...||...|...|.|.|:    :....|.|....|.::.:..|:
 Frog     4 WLLLTLLVCAYVIYLLLGALVISVIESPYEASLRDELRQ----LKSVFLNESPCVNVSSLEAFLE 64

  Fly    68 RISDYCDKPVT-LPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGIP 131
            :|.:.....|: |....:|:  .|....:.|||.|:.:|||||..:|.|.:|:...|.|::||:|
 Frog    65 KIINANKYGVSVLHNASNDS--KWDIASSMFFASTLVTTVGYGYTTPLTDSGKAFCIFYALIGVP 127

  Fly   132 VNGILFAGLGEYFGR-----TFEAIY----RRYKKYKMSTDMHYVPPQLGLITTVVIALIPGIAL 187
            ...::   |..:..|     |.:.|:    :|....||.|.:|:           ...||..:..
 Frog   128 FTMLV---LSSFVQRLMVMFTHKPIHYLQVQRGFDRKMVTQLHF-----------FFLLILVLVF 178

  Fly   188 FLLLPSWVFTYFE-NWPYSISLYYSYVTTTTIGFGDYVPTFGANQPKEFGGWF-VVYQIFVIVW- 249
            ||::||.:|...| .|.:..:.|:.:::..|||.|||||....:|      |. .:|::.|..: 
 Frog   179 FLIIPSAIFNTIETTWSFLDAFYFCFISLCTIGLGDYVPGEQNDQ------WLRKLYKVSVAFYL 237

  Fly   250 FIFSLGYLVMIMTFITRGLQSKKLAYLEQQLSSNLKATQNRIWSGVTKDVGYLRRMLNE 308
            ||..:..|:::.||       .|.|.|.                |:| |:.||.|:.::
 Frog   238 FIGLMAMLLIVQTF-------HKAADLH----------------GLT-DIFYLPRLQDQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 19/53 (36%)
Ion_trans_2 185..269 CDD:285168 25/86 (29%)
kcnk6NP_001120420.1 Ion_trans_2 72..141 CDD:369572 23/73 (32%)
Ion_trans_2 <193..251 CDD:369572 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.