DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and kcnk7

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_001116288.1 Gene:kcnk7 / 100144289 XenbaseID:XB-GENE-5731928 Length:322 Species:Xenopus tropicalis


Alignment Length:288 Identity:67/288 - (23%)
Similarity:125/288 - (43%) Gaps:55/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILLLIFYISYLMFGAAIYYHIEHGEEKISRAEQRKAQIAINEYLLEELGDKNTTTQDEILQRISD 71
            :|||:.|..:|:.||.::..:|..:|:..|   |:.:...:|:|.:.      ....|:|  :.|
 Frog    10 LLLLLSYSLFLLLGAFVFSTLEQPQEERLR---REVETMWSEFLAKH------PCLSEVL--LDD 63

  Fly    72 YCDKP-------VTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIG 129
            :..|.       |::..........|.|..:.||..|..:|:|||:..|.:..|:...:.|::.|
 Frog    64 FIRKALLVKSFGVSVHRNISIHELKWDFISSLFFTGTTLTTIGYGHPFPISLGGKAFCLVYAIFG 128

  Fly   130 IP---------VNGILFAGLGEYFGRTFEAIYRR----YKKYKMSTDMHYVPPQLGLITTVVIAL 181
            ||         |..:|..    .:.:....:.|:    .||      :.::...:.:..|.:|  
 Frog   129 IPLTLSVLSIIVRNLLIL----LWDKPINKLQRQCSISRKK------LEWILASIFIFFTALI-- 181

  Fly   182 IPGIALFLLLPSWVFTYF-ENWPYSISLYYSYVTTTTIGFGDYVPTFGANQPKEFGGWFVVYQIF 245
                  |..:|:.||... |||.|..:||:.:::.:|||.|||||  |....:...   |:|::.
 Frog   182 ------FFFIPAIVFNAIEENWGYVDALYFCFISLSTIGLGDYVP--GERNEQRLP---VLYKLL 235

  Fly   246 VIVWFIFSLGYLVMIMTFITRGLQSKKL 273
            ||.:.:..|..:.:::..|...|...:|
 Frog   236 VICYLLIGLVAVFLVVEVIKNVLNYNRL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 17/62 (27%)
Ion_trans_2 185..269 CDD:285168 25/84 (30%)
kcnk7NP_001116288.1 Ion_trans_2 <88..141 CDD:285168 15/52 (29%)
Ion_trans_2 178..254 CDD:285168 26/88 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.