DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and si:ch211-261a10.5

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:XP_021321992.1 Gene:si:ch211-261a10.5 / 100003275 ZFINID:ZDB-GENE-131127-398 Length:306 Species:Danio rerio


Alignment Length:191 Identity:47/191 - (24%)
Similarity:82/191 - (42%) Gaps:39/191 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SPTTFAGRMIMIAYSVIGIPVNGILFAGLGEYFGRTFEAIYRRYKKYKMSTDM---HYVP----- 168
            :|.|..|::.:|.|.:||.....:.|....|........:..|.:|.:..|..   |.||     
Zfish     3 APATHNGKIFLIFYGLIGCATTMLFFNLFLERMITLITFLTNRCRKQQQRTKQSKRHIVPNVNTH 67

  Fly   169 PQLGLI----------TTVVIALIPGIALFLLL-PSWVFTYFENWPYSISLYYSYVTTTTIGFGD 222
            |:.|.|          .|:::|:   :||.:.| .|.:::..|:|.|..|:|:.:|..||:||||
Zfish    68 PENGDIHESWKPSVYYVTLILAV---VALLVNLGASGLYSAMEDWSYLESMYFCFVAFTTMGFGD 129

  Fly   223 YVPTFGANQPKEFGGWFVVYQIFVIVWFIFSLGYLVMIMTFI--TRGLQSKKLAYLEQQLS 281
            .|           .|....|:    |.:::.:...:||:..:  |..|.|.....::|.|:
Zfish   130 MV-----------SGQKAYYE----VRWVYQVANSLMIILGVSCTYSLVSVTAIIIKQMLN 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 9/31 (29%)
Ion_trans_2 185..269 CDD:285168 23/86 (27%)
si:ch211-261a10.5XP_021321992.1 Ion_trans_2 90..172 CDD:311712 25/99 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590187
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.