DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and kcnk15

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:XP_005161945.1 Gene:kcnk15 / 100000132 ZFINID:ZDB-GENE-080220-30 Length:357 Species:Danio rerio


Alignment Length:397 Identity:94/397 - (23%)
Similarity:166/397 - (41%) Gaps:100/397 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RWILLLIFYISYLMFGAAIYYHIEHGEEKI-------SRAE-QRKAQIAINEYLLEELGDKNTTT 61
            |.:.|::...|||:.|||::..:|...|..       .||| :||.:....:|  :||       
Zfish     7 RTLSLILCIFSYLLVGAAVFVALESDTESARKRMLEHKRAELRRKYRFTDGDY--QEL------- 62

  Fly    62 QDEILQRISDYCDKPVTLPPTYDDTPY----TWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIM 122
             :.:|::..                |:    .|.|..:|:||.||.:|:|||:.:|.|.||::..
Zfish    63 -ERVLRQAE----------------PHRAGTQWRFAGSFYFAITVITTIGYGHAAPGTDAGKLFC 110

  Fly   123 IAYSVIGIPVNGILFAGLGEYFGRTFEAIYRRYKKYKMSTDMHYVPPQLGL----ITTVVIALIP 183
            :.|:.:|||:..::|..|||........:..|.|:            .|||    |:|..:.|:.
Zfish   111 MLYAGLGIPLTLVMFQSLGERMNTGVRFLLSRMKR------------ALGLQRTEISTQNMVLVG 163

  Fly   184 GIALF--LLLPSWVFTYFENWPYSISLYYSYVTTTTIGFGDYV-----PTFGANQPKEFGGWFVV 241
            .::..  |.:.:..|::||:|.:..:.||.::|.|||||||:|     .....|||         
Zfish   164 VLSCLGTLCVGAAAFSHFESWTFFHAYYYCFITLTTIGFGDFVALQKKEDLQENQP--------- 219

  Fly   242 YQIFVIVWFIFSLGYL-----VMIMTFITRGLQSKKLAYLEQ-QLSSNLKATQNRIWSGVTKD-- 298
            |.:|..::.:..|..:     ::::.|:|...:.:|....|: ...::|:|:..|......:|  
Zfish   220 YVLFSFIYILLGLTVIGAFLNLVVLRFLTLNTEDEKRDAAERASQRASLRASSLRKAPAFRRDSQ 284

  Fly   299 ------------VGYLRRMLNELYILKVKFCRKGNRKKPKNKAKTEQKKKSSRY---IAYTLPRS 348
                        ..:||...:.:::.....||       ...|.......|.|.   .|::.|||
Zfish   285 THSRTNLLSPRPTPHLRWFCSRVHLDHTSACR-------NTCAGCSVSSVSCRIHADTAFSSPRS 342

  Fly   349 NSCPDLS 355
            .....||
Zfish   343 TLSAGLS 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 23/53 (43%)
Ion_trans_2 185..269 CDD:285168 24/95 (25%)
kcnk15XP_005161945.1 Ion_trans_2 <77..132 CDD:285168 23/54 (43%)
Ion_trans_2 167..243 CDD:285168 22/84 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.