DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA5 and Abd-B

DIOPT Version :9

Sequence 1:NP_061975.2 Gene:HOXA5 / 3202 HGNCID:5106 Length:270 Species:Homo sapiens
Sequence 2:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster


Alignment Length:331 Identity:77/331 - (23%)
Similarity:123/331 - (37%) Gaps:120/331 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    14 PNGP--DYQLHNYGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSGSGHFGSGERARSYAAS 76
            |.||  ..|.|....|.....|.:...|:.||.                    .|..:.:....:
  Fly   148 PTGPSAQQQQHLTSPHHQQLPQQQTPNSVASGA--------------------SSNLQQQQQQQN 192

Human    77 ASAAPAEPRYSQPATSTHSP--------------QPDPLPCSAVAPSPGSDS------------- 114
            |:.||.:.:...|.|::.||              |..||...|:...||.::             
  Fly   193 AAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPLHIPAIRAGPGFETDTSAAVKRHTAHW 257

Human   115 ---------HHG-------------------------GKNSLSNSSGASADAGS------THIS- 138
                     |:|                         |.|...:.:.::|.|.:      .|:| 
  Fly   258 AYNDEGFNQHYGSGYYDRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSA 322

Human   139 -SREGVGTASGAEEDAPASSEQASAQSEPS------------------PAPPAQPQIYPWMRKLH 184
             :|:.|...|.:..:.|..|.....:..||                  |..| .|.::.|..::.
  Fly   323 AARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTP-NPGLHEWTGQVS 386

Human   185 ISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMK 249
            :          ::.|..|:::|||||||||.||.|:::::|.|:|..|.|:|||:||||||||||
  Fly   387 V----------RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMK 441

Human   250 WKKDNK 255
            .||:::
  Fly   442 NKKNSQ 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA5NP_061975.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 30/186 (16%)
Antp-type hexapeptide 176..181 1/4 (25%)
Homeobox 199..251 CDD:306543 32/51 (63%)
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.