DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA5 and abd-A

DIOPT Version :9

Sequence 1:NP_061975.2 Gene:HOXA5 / 3202 HGNCID:5106 Length:270 Species:Homo sapiens
Sequence 2:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster


Alignment Length:277 Identity:97/277 - (35%)
Similarity:123/277 - (44%) Gaps:67/277 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    25 GDHS-SVSEQFRDSASMHSGRYGYGYNGMDLSVGRSGSGHFGSGERARSYAASASAAPAEPRYSQ 88
            ||.| |.|.....|:|:|          ..|:....||....:...|.|..|:|:||.|....|.
  Fly   199 GDSSCSPSPSASGSSSLH----------RSLNDNSPGSASASASASAASSVAAAAAAAAAAASSS 253

Human    89 PATSTHSPQPDPLPCSAVAPSPGSDSHHGGKNSLSNSSGASADAGS----THISSREGVGTASGA 149
            .|..|....|      .|:..|.|   |||.:.::..:|....:.|    |.::|.:.:...:.|
  Fly   254 FAIPTSKMYP------YVSNHPSS---HGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASA 309

Human   150 E-------EDAPASSEQASAQSE------------PSPAPPAQPQI-------------YPWMRK 182
            .       :.|.|::...||.|.            ..||....|..             ||||..
  Fly   310 SAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTL 374

Human   183 L--------HISHDNIGGPEG---KRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSE 236
            .        .:...:..||.|   :|.|..|||:||||||||||||.||||||||||||||||:|
  Fly   375 TDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTE 439

Human   237 RQIKIWFQNRRMKWKKD 253
            |||||||||||||.||:
  Fly   440 RQIKIWFQNRRMKLKKE 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA5NP_061975.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 27/122 (22%)
Antp-type hexapeptide 176..181 3/17 (18%)
Homeobox 199..251 CDD:306543 46/51 (90%)
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 46/51 (90%)
Abdominal-A 456..478 CDD:289192 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.