DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA5 and Scr

DIOPT Version :9

Sequence 1:NP_061975.2 Gene:HOXA5 / 3202 HGNCID:5106 Length:270 Species:Homo sapiens
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:236 Identity:101/236 - (42%)
Similarity:132/236 - (55%) Gaps:37/236 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    49 YNGMDLSVGRSGSGHFGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCS--------- 104
            |....::.|.||.|.. ||....:.:|:::...::...|....||....|...|.|         
  Fly   169 YANDPVTPGGSGGGGV-SGSNNNNNSANSNNNNSQSLASPQDLSTRDISPKLSPSSVVESVARSL 232

Human   105 ----------AVAPSPGSDSHHGGKNSLSNSSGASADAGSTHISSREGVGTASGAEEDA--PASS 157
                      |.|.:.|.:::|.|       ||.|...|:.::......|..|.:|.|:  .|.|
  Fly   233 NKGVLGGSLAAAAAAAGLNNNHSG-------SGVSGGPGNVNVPMHSPGGGDSDSESDSGNEAGS 290

Human   158 EQASAQSEPSPAPPAQPQIYPWMRKLHI--SHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYL 220
            .|.|...:.:|     |||||||:::|:  |..|..| |.||.||:|||||||||||||||||||
  Fly   291 SQNSGNGKKNP-----PQIYPWMKRVHLGTSTVNANG-ETKRQRTSYTRYQTLELEKEFHFNRYL 349

Human   221 TRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSM 261
            ||||||||||||||:|||||||||||||||||::|:.||::
  Fly   350 TRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA5NP_061975.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 25/120 (21%)
Antp-type hexapeptide 176..181 4/4 (100%)
Homeobox 199..251 CDD:306543 49/51 (96%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 50/52 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5853
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm40809
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4748
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.