DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA5 and bcd

DIOPT Version :9

Sequence 1:NP_061975.2 Gene:HOXA5 / 3202 HGNCID:5106 Length:270 Species:Homo sapiens
Sequence 2:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster


Alignment Length:103 Identity:34/103 - (33%)
Similarity:53/103 - (51%) Gaps:12/103 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   166 PSPAPPAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAH 230
            |:..|  :|.::| ..:|   .|::.....:|.||.:|..|..|||:.|...||||..|..:::.
  Fly    74 PNQMP--KPDVFP-SEEL---PDSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSA 132

Human   231 ALCLSERQIKIWFQNRRMKWK------KDNKLKSMSMA 262
            .|.|...|:||||:|||.:.|      ||...:.|.::
  Fly   133 KLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGMPLS 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA5NP_061975.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 2/8 (25%)
Antp-type hexapeptide 176..181 1/4 (25%)
Homeobox 199..251 CDD:306543 23/51 (45%)
bcdNP_788587.1 Homeobox 106..153 CDD:278475 20/46 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.