DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA5 and lab

DIOPT Version :9

Sequence 1:NP_061975.2 Gene:HOXA5 / 3202 HGNCID:5106 Length:270 Species:Homo sapiens
Sequence 2:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster


Alignment Length:327 Identity:88/327 - (26%)
Similarity:112/327 - (34%) Gaps:119/327 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    26 DHSSVSEQFRDSASMHSGRY---GYGYNGMDLSVGRSGSGHFG-----SGERARSYAASASAAPA 82
            |...:.:|...|...|..::   .|..:.|| |:|.....|.|     .|..|.:          
  Fly   251 DQDPMMQQATQSQMWHHQQHLAGSYALDAMD-SLGMHAHMHHGLPHGHLGNLANN---------- 304

Human    83 EPRYSQPATSTHSPQPDPLPCSAVAPSPGS-DSHHGGKNSLSNSSGASADAGSTHISSREGVGTA 146
             |...||.......||...|......||.: ..||  :||:|.:.|.:.......||......::
  Fly   305 -PHQQQPQVQQQQQQPHQQPQHPQNQSPAAHQQHH--QNSVSPNGGMNRQQRGGVISPGSSTSSS 366

Human   147 SGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMR-----------KLHIS-----HD------- 188
            :.|...|..:|.|:.:.:..|..|     .|.||:           ||..|     ||       
  Fly   367 TSASNGAHPASTQSKSPNHSSSIP-----TYKWMQLKRNVPKPQAPKLPASGIASMHDYQMNGQL 426

Human   189 --------------------------NIGG---------------------PEG----------- 195
                                      .|||                     |.|           
  Fly   427 DMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGSAHPNGMGVGLGSGSGL 491

Human   196 ----------KRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKW 250
                      ...||.:|..|..||||||||||||||.||||||:.|.|:|.|:||||||||||.
  Fly   492 SSCSLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQ 556

Human   251 KK 252
            ||
  Fly   557 KK 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA5NP_061975.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 22/100 (22%)
Antp-type hexapeptide 176..181 2/4 (50%)
Homeobox 199..251 CDD:306543 38/51 (75%)
labNP_476613.1 Homeobox 505..557 CDD:278475 38/51 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.