DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA5 and Dll

DIOPT Version :10

Sequence 1:NP_061975.2 Gene:HOXA5 / 3202 HGNCID:5106 Length:270 Species:Homo sapiens
Sequence 2:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster


Alignment Length:38 Identity:11/38 - (28%)
Similarity:21/38 - (55%) Gaps:7/38 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   141 FTYPLDLIKKRLQVGGFEHARSAFGQVRSYRGLLDLTQ 178
            |::.|:....:::    |.|..||   :.|.|||::|:
  Fly   273 FSFDLEAFAGQME----EQANPAF---KEYHGLLNITK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA5NP_061975.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 9/33 (27%)
Antp-type hexapeptide 176..181 1/3 (33%)
Homeodomain 196..252 CDD:459649
DllNP_001137759.1 Homeodomain 125..181 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.