DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA5 and unpg

DIOPT Version :9

Sequence 1:NP_061975.2 Gene:HOXA5 / 3202 HGNCID:5106 Length:270 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:216 Identity:65/216 - (30%)
Similarity:88/216 - (40%) Gaps:62/216 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    63 HFGSGERARSYAASASAA----PAEPR-YSQPATS-THSPQPDPL-------------PCS--AV 106
            |..:..|.....|:...|    |..|: :|.||.| :|||....|             .||  ::
  Fly   197 HMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISL 261

Human   107 APSPGS-----DSHHGGKNSLSNSSGASADAGSTHISSREGVGTASGAEEDAPASSEQASAQSEP 166
            ..||.:     |....|..:.|:|...|.|.|:   .||...|...|.:.....||..:      
  Fly   262 TMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGA---QSRHEGGGMGGKDSQGNGSSSNS------ 317

Human   167 SPAPPAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHA 231
                                       :.:|.|||:|..|.||||:|||..:||:...|.:||.:
  Fly   318 ---------------------------KSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATS 355

Human   232 LCLSERQIKIWFQNRRMKWKK 252
            |.|||.|:||||||||.|||:
  Fly   356 LKLSEVQVKIWFQNRRAKWKR 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA5NP_061975.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 29/125 (23%)
Antp-type hexapeptide 176..181 0/4 (0%)
Homeobox 199..251 CDD:306543 31/51 (61%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 30/50 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.