DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA5 and ind

DIOPT Version :9

Sequence 1:NP_061975.2 Gene:HOXA5 / 3202 HGNCID:5106 Length:270 Species:Homo sapiens
Sequence 2:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster


Alignment Length:223 Identity:69/223 - (30%)
Similarity:93/223 - (41%) Gaps:61/223 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    64 FGSGERARSYAASASAAPAEPRYSQPATS----THSPQPDPLPCSAVAPSPGSDSHHGGKNSLSN 124
            |.|..::..::......|:.|..:.|.:.    .|:....|:......|.|||..     .|.|.
  Fly   113 FASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFC-----TSPSA 172

Human   125 SSGASADAGSTHISSREGVGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDN 189
            ||.||.|..:..               |.|....   .:.|.|.:|.:.|          :.:.:
  Fly   173 SSSASLDYTNNF---------------DEPQGKR---FKHESSCSPNSSP----------LKNHS 209

Human   190 IGGP------------EGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIW 242
            .|||            ..||.|||:|..|.||||:||..|.||:|.||||||:.|.|||:|:|||
  Fly   210 SGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIW 274

Human   243 FQNRRMKWKKDNKLKSMSMAAAGGAFRP 270
            |||||:|.||            ||:..|
  Fly   275 FQNRRVKQKK------------GGSESP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA5NP_061975.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 21/103 (20%)
Antp-type hexapeptide 176..181 0/4 (0%)
Homeobox 199..251 CDD:306543 35/51 (69%)
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.