DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1637 and cpdA

DIOPT Version :10

Sequence 1:NP_001285095.1 Gene:CG1637 / 32019 FlyBaseID:FBgn0030245 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_417504.1 Gene:cpdA / 947515 ECOCYCID:G7579 Length:275 Species:Escherichia coli


Alignment Length:174 Identity:41/174 - (23%)
Similarity:65/174 - (37%) Gaps:51/174 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 YDAIIHVGDFAYDMNTKNARVGDEFMRQIETVAAY-LPYMVVPGNHEEKFNFSNYRARFSMPGGT 243
            :|.|:..||.|.|.::.      .:....|.:|:: .|.:.:||||:  |..:.|.|        
E. coli    56 FDLIVATGDLAQDQSSA------AYQHFAEGIASFRAPCVWLPGNHD--FQPAMYSA-------- 104

  Fly   244 ENMFYSFDLGPVHFVGISTEVYYFLNYGLKPLV---------------FQFEWLREDLAKANLPE 293
                       :...|||.....|:....:.|:               ||.|||...||.|  ||
E. coli   105 -----------LQDAGISPAKRVFIGEQWQILLLDSQVFGVPHGELSEFQLEWLERKLADA--PE 156

  Fly   294 NRNKRPWIILYGHRPM--YCSNENDNDCTHSETLTRVGWPFVHM 335
                |..::|..|.|:  .||..:.:...::..|..|...|.|:
E. coli   157 ----RHTLLLLHHHPLPAGCSWLDQHSLRNAGELDTVLAKFPHV 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1637NP_001285095.1 Pur_ac_phosph_N 38..142 CDD:465220
MPP_PAPs 149..451 CDD:277318 41/174 (24%)
cpdANP_417504.1 PRK11148 1..275 CDD:182997 41/174 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.