DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1637 and DCR2

DIOPT Version :9

Sequence 1:NP_001285095.1 Gene:CG1637 / 32019 FlyBaseID:FBgn0030245 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_013465.1 Gene:DCR2 / 851075 SGDID:S000004353 Length:578 Species:Saccharomyces cerevisiae


Alignment Length:397 Identity:75/397 - (18%)
Similarity:126/397 - (31%) Gaps:156/397 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 PSLAIYGDMGNENAQSLARLQQETQRGMYDAI----IHVG------------------------- 187
            |:...|..:|.....:.|:..|||..|.:..:    :|:|                         
Yeast   220 PAYLTYKFVGTRPVDTGAQRLQETDEGKFKIVQLADLHLGVGESECIDEYPKHEACKADPKTETF 284

  Fly   188 -DFAYDMN-------TKNARVGDEFMRQIETV---------AAYLPYMVVPGNHEEKFNFSNYRA 235
             ....|:.       |.:..:||..::..|||         |..:|:.:|.|||:::.:.:.::.
Yeast   285 VQQVLDIEKPQLVVFTGDQIMGDRSIQDSETVLLKAVAPVIARKIPWAMVWGNHDDEGSLTRWQL 349

  Fly   236 ------------RFSMPGGTENMF----YSFDLGPVHFVGISTEV----YYFLN---YGLKPLVF 277
                        :||.....:|.|    |.:.:    |....|||    .|||:   |.....::
Yeast   350 SEIASVLPYSLFKFSPHDTHDNTFGVGNYIYQI----FSNNDTEVPVGTLYFLDSHKYSTVGKIY 410

  Fly   278 Q-FEWLR-------EDLAKAN---------------LPENRN---------KRPWIILYGH---R 307
            . ::|::       ||....|               |||..|         |.|.|.:|..   .
Yeast   411 PGYDWIKESQWKYIEDYHDVNLKFKTGLSMAFFHIPLPEYLNIESKTHPGEKNPLIGMYKEGVTA 475

  Fly   308 PMYCSNENDNDCTHSETLTRVGWPFVHMFGLEPLLYEFGVDVAIWAHEHSYERLWPIYDYKVRNG 372
            |.|          :||.:|              .|....|||....|:|       ..||.:|  
Yeast   476 PKY----------NSEGIT--------------TLDRLSVDVVSCGHDH-------CNDYCLR-- 507

  Fly   373 TLKDSPYNDPSAP--VHIVTGSAGCKEGREPFKG-----KIPEWSAFHSQDYGYTRLKAHNRTHI 430
                    |.|.|  :.:..|..|.:.|...:.|     :|.|.:...:..:.:.||....:...
Yeast   508 --------DDSTPNKIWLCYGGGGGEGGYAGYGGTERRIRIYEINVNENNIHTWKRLNGSPKEIF 564

  Fly   431 HFEQVSD 437
            .|:.:.|
Yeast   565 DFQSMLD 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1637NP_001285095.1 PLN02533 20..449 CDD:215292 75/397 (19%)
Pur_ac_phosph_N 38..142 CDD:293262
MPP_PAPs 149..451 CDD:277318 75/397 (19%)
DCR2NP_013465.1 MPP_Dcr2 246..518 CDD:277329 58/316 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.