DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1637 and PAP29

DIOPT Version :10

Sequence 1:NP_001285095.1 Gene:CG1637 / 32019 FlyBaseID:FBgn0030245 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_201119.1 Gene:PAP29 / 836435 AraportID:AT5G63140 Length:389 Species:Arabidopsis thaliana


Alignment Length:153 Identity:29/153 - (18%)
Similarity:60/153 - (39%) Gaps:41/153 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 DAIIHVGDFAYDMNTKNARVGDEFMRQIE-----TVAAYLPYMVVPGNHEEKFNFS--------- 231
            |.|:..||..:..:.|:|      ::.|.     .:|:.:|::.:.|||:::..|:         
plant    95 DLIVFTGDNIFGFDVKDA------LKSINAAFAPAIASKIPWVAILGNHDQESTFTRQQVMNHIV 153

  Fly   232 ---NYRARFSMPGGTENM--FYSFDLGPVH------FVGISTEVYYFL---NYGLKPLVFQFEWL 282
               |..::.:.|.....:  |.:::| .:|      ....|....|||   :|...|.:..::|:
plant   154 KLPNTLSQVNPPEAAHYIDGFGNYNL-QIHGAADSKLQNKSVLNLYFLDSGDYSSVPYMEGYDWI 217

  Fly   283 RE------DLAKANLPENRNKRP 299
            :.      |.....|....|.:|
plant   218 KTSQQFWFDRTSKRLKREYNAKP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1637NP_001285095.1 Pur_ac_phosph_N 38..142 CDD:465220
MPP_PAPs 149..451 CDD:277318 29/153 (19%)
PAP29NP_201119.1 MPP_Dcr2 45..330 CDD:277329 29/153 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.