DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1637 and ADPRM

DIOPT Version :9

Sequence 1:NP_001285095.1 Gene:CG1637 / 32019 FlyBaseID:FBgn0030245 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_064618.3 Gene:ADPRM / 56985 HGNCID:30925 Length:342 Species:Homo sapiens


Alignment Length:379 Identity:73/379 - (19%)
Similarity:124/379 - (32%) Gaps:153/379 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PSASVDWSPSLAIYGDMGNENAQSLARLQ-----QETQRGMY-DAIIHVGDFAYDMNTKNA---- 198
            |.|..|.|..|..:|.:.:   ...|.|:     |.|:|..| .:::|:.....|.|.:::    
Human     7 PEALSDSSERLFSFGVIAD---VQFADLEDGFNFQGTRRRYYRHSLLHLQGAIEDWNNESSMPCC 68

  Fly   199 --RVGD----------EFMRQIETVAAYLPYMVVP-----GNHE------EKFNFSNYRARF--- 237
              ::||          ...:.:|.|......:.||     ||||      |....|....:|   
Human    69 VLQLGDIIDGYNAQYNASKKSLELVMDMFKRLKVPVHHTWGNHEFYNFSREYLTHSKLNTKFLED 133

  Fly   238 -------SMPGGTENMFYSFDLGPVHFV------------------------------------- 258
                   :||  :|: :|::     |||                                     
Human   134 QIVHHPETMP--SED-YYAY-----HFVPFPKFRFILLDAYDLSVLGVDQSSPKYEQCMKILREH 190

  Fly   259 ----------GISTEVYYFLNYGLKPLVFQFEWLREDLAKANLPENRNKRPWIILYGHRPMYCSN 313
                      |:|...:...|.|...  .|..||.|.|..::  .|:.|   :::..|.|:| .:
Human   191 NPNTELNSPQGLSEPQFVQFNGGFSQ--EQLNWLNEVLTFSD--TNQEK---VVIVSHLPIY-PD 247

  Fly   314 ENDNDCTHSETLTRVGWPFVHMFGLEPLLYEFGVDVAIWAHE--------HSYERLW---PIYDY 367
            .:||.|        :.|.:.....:            ||:||        |:::..:   |...|
Human   248 ASDNVC--------LAWNYRDALAV------------IWSHECVVCFFAGHTHDGGYSEDPFGVY 292

  Fly   368 KVR-NGTLKDSPYNDPSAPVHIVTGSAGCKEGREPFKGKIPE-------WSAFH 413
            .|. .|.::.:|.:.....||:.......| ||    |::|:       ..|||
Human   293 HVNLEGVIETAPDSQAFGTVHVYPDKMMLK-GR----GRVPDRIMNYKKERAFH 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1637NP_001285095.1 PLN02533 20..449 CDD:215292 73/379 (19%)
Pur_ac_phosph_N 38..142 CDD:293262
MPP_PAPs 149..451 CDD:277318 71/374 (19%)
ADPRMNP_064618.3 MPP_Nbla03831 18..322 CDD:277341 60/342 (18%)
Metallophos 69..280 CDD:278574 43/246 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.