DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1637 and CPPED1

DIOPT Version :9

Sequence 1:NP_001285095.1 Gene:CG1637 / 32019 FlyBaseID:FBgn0030245 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_060810.2 Gene:CPPED1 / 55313 HGNCID:25632 Length:314 Species:Homo sapiens


Alignment Length:333 Identity:71/333 - (21%)
Similarity:122/333 - (36%) Gaps:98/333 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 QATQFIHRVTLRDLEPNATYSYHCGSDFGWSAIF--------QFRTVPSASVDWSPSLAIYGDM- 160
            :|....||...|.|.     ::....:..|...|        ||..:.:    ||.     ||. 
Human     5 EAGGVFHRARGRTLA-----AFPAEKESEWKGPFYFILGADPQFGLIKA----WST-----GDCD 55

  Fly   161 --GNENAQSLARLQQETQRGMYDAI----------IHVGDFAYDMNTKNARV--GDEFMRQIETV 211
              |:|..|.:...:|..|     ||          :..||..:.|..|..|.  .::..|.:..|
Human    56 NGGDEWEQEIRLTEQAVQ-----AINKLNPKPKFFVLCGDLIHAMPGKPWRTEQTEDLKRVLRAV 115

  Fly   212 AAYLPYMVVPGNHEEKFNFSNYRA-----RFSMPGGTENMFYSFDLGPVHFVGISTEVYYFLNYG 271
            ...:|.::|.|||:    ..|...     .|....|.:  ::||.:|.|.|:.::::.|.  |..
Human   116 DRAIPLVLVSGNHD----IGNTPTAETVEEFCRTWGDD--YFSFWVGGVLFLVLNSQFYE--NPS 172

  Fly   272 LKPLV--FQFEWLREDLAKANLPENRNKRPWIILYGHRPMYCSNENDNDCTH----SETLTRVGW 330
            ..|.:  .|.:||.|.|:.|.....::    .|::.|.|::..:.:::|..:    ..|..::..
Human   173 KCPSLKQAQDQWLDEQLSIARQRHCQH----AIVFQHIPLFLESIDEDDDYYFNLSKSTRKKLAD 233

  Fly   331 PFVHMFGLEPLLYEFGVDVAIWAHEHSYERLWPIYDYKVRN--GTLKDSPYNDPSAPVHIVTGSA 393
            .|:|.          ||.|....|.|             ||  ||.::...        :|:.:.
Human   234 KFIHA----------GVKVVFSGHYH-------------RNAGGTYQNLDM--------VVSSAI 267

  Fly   394 GCKEGREP 401
            ||:.||:|
Human   268 GCQLGRDP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1637NP_001285095.1 PLN02533 20..449 CDD:215292 71/333 (21%)
Pur_ac_phosph_N 38..142 CDD:293262 9/44 (20%)
MPP_PAPs 149..451 CDD:277318 62/281 (22%)
CPPED1NP_060810.2 MPP_CSTP1 29..295 CDD:277340 66/304 (22%)
Catalytic 47..250 52/251 (21%)
CpdA 67..>269 CDD:224327 50/249 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.