DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1637 and acp5b

DIOPT Version :9

Sequence 1:NP_001285095.1 Gene:CG1637 / 32019 FlyBaseID:FBgn0030245 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001002452.1 Gene:acp5b / 436725 ZFINID:ZDB-GENE-040718-151 Length:327 Species:Danio rerio


Alignment Length:299 Identity:71/299 - (23%)
Similarity:115/299 - (38%) Gaps:97/299 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 DWS--PSLAIYGDMGNENAQSLARLQQETQRGMYDAIIHVGD-FAYDMNTKNARVGD-EFMRQIE 209
            ||.  ||...|.....:.|:.|||:.|.:  |: |.::.:|| |.|| ..|:  |.| .|....|
Zfish    36 DWGGRPSYPFYTPHEADTAKELARVAQSS--GL-DFVLSLGDNFYYD-GVKD--VDDTRFKFSYE 94

  Fly   210 TVAAY-----LPYMVVPGNHEEKFNFSNYRARFSMPGGTENMFYSFDLGPVHFVGISTEVYYFLN 269
            .|.::     :|:.::.|||:.:.|.|   |:.:....:|...|             .::||.||
Zfish    95 QVFSHPALMTIPWYLIAGNHDHRGNVS---AQIAYSSRSERWIY-------------PDLYYELN 143

  Fly   270 Y-------------------------GLKPLVFQFEWLREDLAKANLP----ENR---NKRPWII 302
            :                         ||.|:.      .||||.||..    |.|   .|..::|
Zfish   144 FKVPHSNTSLTILMTDTVVVCGNTYDGLDPVG------PEDLAAANKQLAWIEQRLQSTKADFVI 202

  Fly   303 LYGHRPMY-CSNENDNDCTHSETLTRVGWPFVHMFGLEPLLYEFGVDVAIWAHEHSYERL----- 361
            :.||.|:: ..:.....|..|:              |.|||.::.|.:.:..|:||.:.:     
Zfish   203 VVGHYPIWSIGHHGPTKCLISK--------------LRPLLKKYNVSLYLSGHDHSLQFIREDDG 253

  Fly   362 --WPIYDYKVRNGTLKDSPYNDPSA------PVHIVTGS 392
              :.:....|...:..|...:.|||      ||:..:||
Zfish   254 SSFVVSGAGVEEDSSTDHRKSFPSAWQLFSSPVNQTSGS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1637NP_001285095.1 PLN02533 20..449 CDD:215292 71/299 (24%)
Pur_ac_phosph_N 38..142 CDD:293262
MPP_PAPs 149..451 CDD:277318 71/299 (24%)
acp5bNP_001002452.1 MPP_ACP5 29..312 CDD:277324 71/299 (24%)
Metallophos 29..243 CDD:278574 60/248 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.