Sequence 1: | NP_001285095.1 | Gene: | CG1637 / 32019 | FlyBaseID: | FBgn0030245 | Length: | 459 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021335710.1 | Gene: | adprm / 393393 | ZFINID: | ZDB-GENE-040426-1406 | Length: | 352 | Species: | Danio rerio |
Alignment Length: | 271 | Identity: | 57/271 - (21%) |
---|---|---|---|
Similarity: | 88/271 - (32%) | Gaps: | 99/271 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 157 YGDMGNENAQSLARLQQETQRGMYD---------------AIIHVGDFAYDMNTKNARVGDEFMR 206
Fly 207 QIETVAAYLPYMVVP-----GNHEEKFNFS-----NYRARFSMPGGTE-------NMFYSFDLGP 254
Fly 255 V-HFVGISTEVYYFLNYGLKPLVFQFEWLREDLAKANLPENRNK--RPWIILYGHRPMYCSNEND 316
Fly 317 NDC-----THSETLTRV-GW---------------PFVHMFGLEPLLYEFG----------VDVA 350
Fly 351 IWAHEHSYERL 361 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1637 | NP_001285095.1 | PLN02533 | 20..449 | CDD:215292 | 57/271 (21%) |
Pur_ac_phosph_N | 38..142 | CDD:293262 | |||
MPP_PAPs | 149..451 | CDD:277318 | 57/271 (21%) | ||
adprm | XP_021335710.1 | MPP_Nbla03831 | 6..339 | CDD:277341 | 57/271 (21%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1409 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |