DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1637 and adprm

DIOPT Version :9

Sequence 1:NP_001285095.1 Gene:CG1637 / 32019 FlyBaseID:FBgn0030245 Length:459 Species:Drosophila melanogaster
Sequence 2:XP_021335710.1 Gene:adprm / 393393 ZFINID:ZDB-GENE-040426-1406 Length:352 Species:Danio rerio


Alignment Length:271 Identity:57/271 - (21%)
Similarity:88/271 - (32%) Gaps:99/271 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 YGDMGNENAQSLARLQQETQRGMYD---------------AIIHVGDFAYDMNTKNARVGDEFMR 206
            |.|:  |:.::..|.::...||..|               .::.:||.....|.:.    |...|
Zfish    16 YADI--EDGENYLRTRRRYYRGSADLLRDAVLQWRRERVQCVVQLGDIIDGHNRRR----DASDR 74

  Fly   207 QIETVAAYLPYMVVP-----GNHEEKFNFS-----NYRARFSMPGGTE-------NMFYSFDLGP 254
            .::||.|.|....|.     ||| |.:|||     :.|...:...||:       :..|:::..|
Zfish    75 ALDTVMAELDACSVDVHHVWGNH-EFYNFSRPSLLSSRLNSAQRTGTDTGSDLIGDDIYAYEFSP 138

  Fly   255 V-HFVGISTEVYYFLNYGLKPLVFQFEWLREDLAKANLPENRNK--RPWIILYGHRPMYCSNEND 316
            . :|..:..:.|                   ||:.....|...|  ..|.||..|      |.|.
Zfish   139 APNFRFVLLDAY-------------------DLSVIGREEESEKHTHSWRILTQH------NHNL 178

  Fly   317 NDC-----THSETLTRV-GW---------------PFVHMFGLEPLLYEFG----------VDVA 350
            .|.     ||:.|.|.. .|               |.|.: |||....:|.          :|..
Zfish   179 QDLNQPPGTHTHTHTHTHSWRILTQHNHNLQDLNQPPVSV-GLEQRFVKFNGGFSEQQLQWLDAV 242

  Fly   351 IWAHEHSYERL 361
            :...:|..||:
Zfish   243 LTLSDHKQERV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1637NP_001285095.1 PLN02533 20..449 CDD:215292 57/271 (21%)
Pur_ac_phosph_N 38..142 CDD:293262
MPP_PAPs 149..451 CDD:277318 57/271 (21%)
adprmXP_021335710.1 MPP_Nbla03831 6..339 CDD:277341 57/271 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.