DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1637 and Cpped1

DIOPT Version :9

Sequence 1:NP_001285095.1 Gene:CG1637 / 32019 FlyBaseID:FBgn0030245 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001013985.1 Gene:Cpped1 / 302890 RGDID:1306568 Length:312 Species:Rattus norvegicus


Alignment Length:325 Identity:64/325 - (19%)
Similarity:117/325 - (36%) Gaps:87/325 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 ATQFIHRVTLRDLEPNATYSYHCGSDFGWSAIFQFRTVPSASVD------WSPSLAIYGDMGNEN 164
            |....||...|.|:     ::....:..|:..|.|  |..|...      ||......|  |:|.
  Rat     6 AADVFHRARGRTLD-----AFSSEKEREWTGPFYF--VQGADPQFGLMKAWSTGNCDNG--GDEW 61

  Fly   165 AQSLARLQQETQRGMYDAI----------IHVGDFAYDMNTKNARVGD--EFMRQIETVAAYLPY 217
            .|.:...:|..     :||          :..||..:.|.....|...  :..|.::.|...:|.
  Rat    62 GQEIRLTEQAV-----EAINKLNPKPKFFVLCGDLVHAMPGTRWRKEQTRDLQRVLKVVDQDIPL 121

  Fly   218 MVVPGNHEEKFNFSNYRA-----RFSMPGGTENMFYSFDLGPVHFVGISTEVYYFLNY--GLKPL 275
            ::|.|||:    ..|...     .|....|.:  ::||.:|...|:.::::..|..:.  .||..
  Rat   122 VLVSGNHD----LGNAPTAETVEEFCQTWGDD--YFSFWVGGALFLVLNSQFLYDASKCPALKQA 180

  Fly   276 VFQFEWLREDLAKANLPENRNKRPWIILYGHRPMYCSNENDNDCTHSETLTRVGWPFVHMFGLEP 340
              |..||.:.|:.|...:.::    .|::.|.|::..:.:::|...:.|.|          ..:.
  Rat   181 --QDHWLDQQLSIAEQQQCQH----AIVFQHIPLFLKSIDEDDDYFNLTKT----------VRQE 229

  Fly   341 LLYEF---GVDVAIWAHEHSYERLWPIYDYKVRN--GTLKDSPYNDPSAPVHIVTGSAGCKEGRE 400
            |..:|   |:......|.|             ||  ||.::...        :|:.:.||:.|::
  Rat   230 LADKFTRAGIRAVFSGHYH-------------RNAGGTYQNLDM--------VVSSAIGCQLGKD 273

  Fly   401  400
              Rat   274  273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1637NP_001285095.1 PLN02533 20..449 CDD:215292 64/325 (20%)
Pur_ac_phosph_N 38..142 CDD:293262 8/35 (23%)
MPP_PAPs 149..451 CDD:277318 54/282 (19%)
Cpped1NP_001013985.1 MPP_CSTP1 29..294 CDD:277340 59/297 (20%)
CpdA 33..>268 CDD:224327 55/286 (19%)
Catalytic. /evidence=ECO:0000250 47..250 46/244 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.