DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1637 and Acp5

DIOPT Version :9

Sequence 1:NP_001285095.1 Gene:CG1637 / 32019 FlyBaseID:FBgn0030245 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_062017.2 Gene:Acp5 / 25732 RGDID:2022 Length:335 Species:Rattus norvegicus


Alignment Length:336 Identity:77/336 - (22%)
Similarity:127/336 - (37%) Gaps:102/336 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 HC---GSDFGWSAIFQFRTVPSASVDWSPSLAIYGDMGNENAQSLARLQQETQRGMYDAIIHVGD 188
            ||   .|...:.|:..:..||:|....:..:|        ||:.:||..|....   |.|:.:||
  Rat    28 HCTAPASTLRFVAVGDWGGVPNAPFHTAREMA--------NAKEIARTVQIMGA---DFIMSLGD 81

  Fly   189 FAY-----DMNTKNARVGDEFMRQIETVAA-----YLPYMVVPGNHE---------------EKF 228
            ..|     |.|.|      .|....|.|.:     .:|:.|:.|||:               :::
  Rat    82 NFYFTGVHDANDK------RFQETFEDVFSDRALRNIPWYVLAGNHDHLGNVSAQIAYSKISKRW 140

  Fly   229 NFSN--YRARFSMPGGTENMFYS-FDLGPVHFVGISTEVYYFLNY------GLKPLVFQFEWLRE 284
            ||.:  ||.||.:|  ..|:..: |.|..|...|.|.:   |::.      .|.....|..||::
  Rat   141 NFPSPYYRLRFKVP--RSNITVAIFMLDTVMLCGNSDD---FVSQQPEMPRDLGVARTQLSWLKK 200

  Fly   285 DLAKANLPENRNKRPWIILYGHRPMYCSNENDNDCTHSETLTRVGWPFVHMFGLEPLLYEFGVDV 349
            .||.|       |..::::.||.|::...|      |..|...|.       .|.|||..:||..
  Rat   201 QLAAA-------KEDYVLVAGHYPIWSIAE------HGPTRCLVK-------NLRPLLAAYGVTA 245

  Fly   350 AIWAHEHSYERLWPIYDYKVRNGTLKDSPYNDPSAPVHIVTGSAGCKEGREPFKGKIPE-WSAFH 413
            .:..|:|:.:.|                  .|.:...::::|:....:.....:.|:|. :..||
  Rat   246 YLCGHDHNLQYL------------------QDENGVGYVLSGAGNFMDPSVRHQRKVPNGYLRFH 292

  Fly   414 --SQDY--GYT 420
              |:|.  |:|
  Rat   293 YGSEDSLGGFT 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1637NP_001285095.1 PLN02533 20..449 CDD:215292 77/336 (23%)
Pur_ac_phosph_N 38..142 CDD:293262 4/17 (24%)
MPP_PAPs 149..451 CDD:277318 70/311 (23%)
Acp5NP_062017.2 MPP_ACP5 36..321 CDD:277324 74/328 (23%)
Metallophos 36..252 CDD:278574 62/257 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.