DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2202 and INSM2

DIOPT Version :9

Sequence 1:NP_572657.2 Gene:CG2202 / 32014 FlyBaseID:FBgn0030240 Length:889 Species:Drosophila melanogaster
Sequence 2:NP_115983.3 Gene:INSM2 / 84684 HGNCID:17539 Length:566 Species:Homo sapiens


Alignment Length:531 Identity:98/531 - (18%)
Similarity:152/531 - (28%) Gaps:210/531 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 AFQCNTNPISSNEDDGEEANGANQTLWLHIK---PEPCLEAEEVDLAMQLKLEKKR---RRREKA 347
            ||.|:..|.:: ...||:       ..|.::   |||.|:.:...|:..|:..|:.   .||.||
Human   147 AFSCSVAPAAA-PTPGEQ-------FLLPLRAPFPEPALQPDPAPLSAALQSLKRAAGGERRGKA 203

  Fly   348 EAQAETSIDRTVKNEHIAIGDSQFSIKEENQLVGSDDEAPMGVEDFMKLHVSGELPLSDEERFDG 412
            ....             |.|.:...||:...:              .||               .
Human   204 PTDC-------------ASGPAAAGIKKPKAM--------------RKL---------------S 226

  Fly   413 FADDDSDLDDDDDDDDEEDAGDDDDGEFRLKQEPLDGEKPLKKAKSGRRRRRRNKDEPNPDNRCE 477
            |||:                         :...|:.|.|..::......|.......|..:..|:
Human   227 FADE-------------------------VTTSPVLGLKIKEEEPGAPSRGLGGSRTPLGEFICQ 266

  Fly   478 VCQRTFSRHCHLLRHKLSHLEKKPHNCPHCPKAFARSDHLKAH---------------VQSL--- 524
            :|:..::....|.:|:.|.:.:..:.||.|.|.|:...:|.:|               |.|.   
Human   267 LCKEQYADPFALAQHRCSRIVRVEYRCPECDKVFSCPANLASHRRWHKPRPAAANAATVSSADGK 331

  Fly   525 ---HSNKEHKCSLCEAAF-------SRLD-ALERHKVSK-HNGEGLEPGSELK--LQLAEH---- 571
               .|:...:.|...|:|       ||:: ..::|..:: .:|....|.|..:  ||:..|    
Human   332 PPSSSSSSSRDSGAIASFLAEGKENSRIERTADQHPQARDSSGADQHPDSAPRQGLQVLTHPEPP 396

  Fly   572 ------------------------------TCEYCSKRFSSKTYLRKHTLLHTDFLYACKTCDET 606
                                          .|.||.|:|..:.|||||...|           |.
Human   397 LPQGPYTEGVLGRRVPVPGSTSGGRGSEIFVCPYCHKKFRRQAYLRKHLSTH-----------EA 450

  Fly   607 FRERAQLREHEKTHTGQRNFLCCICGDSFARNDYLRVHMRRHNGEKPYKCRFCVKAFPRATDLKV 671
            ...||..............|.|.:||          .|                  ||.|...:.
Human   451 GSARALAPGFGSERGAPLAFACPLCG----------AH------------------FPTADIREK 487

  Fly   672 HERYH-----------TGTKPNLCNTCGKSFHRAYNLTIHMRTHTGERPYKCDQCPKSFTQSNDL 725
            |..:|           .|..|......|.|...|..:            :.|..||.:|..|..|
Human   488 HRLWHAVREELLLPALAGAPPETSGPSGPSDGSAQQI------------FSCKHCPSTFFSSPGL 540

  Fly   726 KAHIRR-HTGE 735
            ..||.: |..|
Human   541 TRHINKCHPSE 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2202NP_572657.2 zf-AD 45..121 CDD:285071
C2H2 Zn finger 150..171 CDD:275368
C2H2 Zn finger 192..213 CDD:275370
C2H2 Zn finger 221..239 CDD:275370
COG5048 <443..730 CDD:227381 68/363 (19%)
C2H2 Zn finger 476..496 CDD:275368 4/19 (21%)
zf-H2C2_2 488..513 CDD:290200 8/24 (33%)
C2H2 Zn finger 504..525 CDD:275368 9/41 (22%)
C2H2 Zn finger 532..548 CDD:275368 5/23 (22%)
C2H2 Zn finger 573..593 CDD:275368 10/19 (53%)
C2H2 Zn finger 600..620 CDD:275368 3/19 (16%)
zf-H2C2_2 613..637 CDD:290200 4/23 (17%)
C2H2 Zn finger 628..648 CDD:275368 4/19 (21%)
zf-H2C2_2 640..663 CDD:290200 1/22 (5%)
C2H2 Zn finger 656..676 CDD:275368 4/19 (21%)
C2H2 Zn finger 684..704 CDD:275368 3/19 (16%)
zf-C2H2 684..704 CDD:278523 3/19 (16%)
zf-H2C2_2 696..721 CDD:290200 4/24 (17%)
C2H2 Zn finger 712..732 CDD:275368 8/20 (40%)
C2H2 Zn finger 739..755 CDD:275368
INSM2NP_115983.3 SNAG domain. /evidence=ECO:0000250 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..117
PdxA 140..>203 CDD:294567 16/63 (25%)
C2H2 Zn finger 265..285 CDD:275368 4/19 (21%)
zf-C2H2 291..313 CDD:278523 7/21 (33%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 310..418 15/107 (14%)
zf-C2H2 426..448 CDD:278523 10/21 (48%)
C2H2 Zn finger 428..448 CDD:275368 10/19 (53%)
C2H2 Zn finger 472..492 CDD:275368 8/47 (17%)
C2H2 Zn finger 527..548 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.