DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2202 and vezf1b

DIOPT Version :9

Sequence 1:NP_572657.2 Gene:CG2202 / 32014 FlyBaseID:FBgn0030240 Length:889 Species:Drosophila melanogaster
Sequence 2:NP_001073432.1 Gene:vezf1b / 556915 ZFINID:ZDB-GENE-060825-121 Length:460 Species:Danio rerio


Alignment Length:417 Identity:99/417 - (23%)
Similarity:151/417 - (36%) Gaps:129/417 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   499 KKPHNCPHCPKAFARSDHLKAHVQSLHS-----NKEHKCSLCEAAFSRLDALERHK--------- 549
            |.|..|.:|.|||..|.||:.| :|.|:     ::..|.:........:..:.|..         
Zfish    88 KTPFICSYCSKAFRDSYHLRRH-ESCHTGIKMVSRPKKTTTAPTMVPLISTVPRDNNGNPSYVST 151

  Fly   550 ---------VSKHNGEGL-------------EPGSELKLQLAEHTCEYCSKRFSSKTYLRKHTLL 592
                     .|.....|:             :|...:|   ..|.||.|.|.|....:|.:|.|.
Zfish   152 VAGILTTATTSASTAAGIMSVLPQQQPTVPKKPPKPVK---KNHGCEMCGKAFRDVYHLNRHKLS 213

  Fly   593 HTDFL-YACKTCDETFRERAQLREHEKTHTG--QRNFLCCICGDSFARNDYLRVHMRR-HNGEKP 653
            |:|.. :.|..|.:.|:.:.::..|.::|.|  .:.::|.:||..|:|.|:|..|::. |:.|:|
Zfish   214 HSDEKPFECPICHQRFKRKDRMTYHVRSHDGGVHKPYICSVCGKGFSRPDHLSCHVKHVHSTERP 278

  Fly   654 YKCRF--CVKAFPRATDLKVHERYHTGTKPNLCNTCGKSFHRAYNLTIHMRTH--TGERPYKCDQ 714
            :||:.  |..||.....|:.|...|.|..  .||.|||....|| :|.|::||  ||        
Zfish   279 FKCQVTACTSAFATKDRLRSHMIRHEGKV--TCNICGKMLSAAY-ITSHLKTHGQTG-------- 332

  Fly   715 CPKSFTQSNDLKAHIRRHTGERYKCPHCDAYFLQLYNMRNHCMSAHNKHIETKTGRLQRTGLLDD 779
                ||.:                   |:.      :..|.|.||....:...|.          
Zfish   333 ----FTST-------------------CNK------DSNNVCNSASATPVTASTA---------- 358

  Fly   780 GGQSHLTTVVMPPARYPNELDPQLAATAAATAAGGAESTSSTTVIHSPGT--YNATAAAPANTFD 842
               |:.|.::...|..|            .|.|.....|::|..|.||.:  :..|..||.|.  
Zfish   359 ---SNTTAMIRGSASNP------------VTIAAQMNITTNTVNITSPVSLQHPVTITAPVNI-- 406

  Fly   843 GANFTPTAVNTPAPFGAFNFPPAVMAH 869
                  .:||.||.      .|..:||
Zfish   407 ------ASVNIPAT------APMNIAH 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2202NP_572657.2 zf-AD 45..121 CDD:285071
C2H2 Zn finger 150..171 CDD:275368
C2H2 Zn finger 192..213 CDD:275370
C2H2 Zn finger 221..239 CDD:275370
COG5048 <443..730 CDD:227381 71/274 (26%)
C2H2 Zn finger 476..496 CDD:275368
zf-H2C2_2 488..513 CDD:290200 7/13 (54%)
C2H2 Zn finger 504..525 CDD:275368 10/20 (50%)
C2H2 Zn finger 532..548 CDD:275368 0/15 (0%)
C2H2 Zn finger 573..593 CDD:275368 8/19 (42%)
C2H2 Zn finger 600..620 CDD:275368 4/19 (21%)
zf-H2C2_2 613..637 CDD:290200 7/25 (28%)
C2H2 Zn finger 628..648 CDD:275368 8/20 (40%)
zf-H2C2_2 640..663 CDD:290200 8/25 (32%)
C2H2 Zn finger 656..676 CDD:275368 6/21 (29%)
C2H2 Zn finger 684..704 CDD:275368 9/19 (47%)
zf-C2H2 684..704 CDD:278523 9/19 (47%)
zf-H2C2_2 696..721 CDD:290200 7/26 (27%)
C2H2 Zn finger 712..732 CDD:275368 2/19 (11%)
C2H2 Zn finger 739..755 CDD:275368 1/15 (7%)
vezf1bNP_001073432.1 C2H2 Zn finger 93..113 CDD:275368 10/20 (50%)
C2H2 Zn finger 194..214 CDD:275368 8/19 (42%)
zf-H2C2_2 206..231 CDD:290200 8/24 (33%)
C2H2 Zn finger 222..242 CDD:275368 4/19 (21%)
C2H2 Zn finger 252..270 CDD:275368 8/17 (47%)
C2H2 Zn finger 281..303 CDD:275368 6/21 (29%)
C2H2 Zn finger 309..328 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.