DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2202 and CG17801

DIOPT Version :9

Sequence 1:NP_572657.2 Gene:CG2202 / 32014 FlyBaseID:FBgn0030240 Length:889 Species:Drosophila melanogaster
Sequence 2:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster


Alignment Length:486 Identity:103/486 - (21%)
Similarity:156/486 - (32%) Gaps:192/486 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 LWL--------HIKPEPCLEAEEVDLAMQLKLEKK-RRRREKAEAQAETSIDRTVKNEHIAIGDS 369
            :||        ||.|. ||.    ||...:||:|: :|...:|..:.|:.:|             
  Fly    40 IWLEQNERQPRHICPS-CLN----DLNTSIKLKKRIQRVHNEATLRRESGLD------------- 86

  Fly   370 QFSIKEENQLVGSDDEAPMGVEDFMKLHVSGELPLSDEERFDGFADDDSDLDDDDDDDDE----E 430
                 |:.:...||.| |.|                          |.|||:.::..|.|    :
  Fly    87 -----EDLESTVSDIE-PEG--------------------------DSSDLESEESYDSENYPFD 119

  Fly   431 DAGDDDDGEFRLKQE--------PLDGEKPLKKAKSGRRRRRRNKDEPNPDNRCEVCQRTFSRHC 487
            ...::.|.:..|..|        |.|.|.||                                  
  Fly   120 KKAEESDIDLNLAHEDRRNEPHNPYDSETPL---------------------------------- 150

  Fly   488 HLLRHKLSHLEKKPHNCPHCPKAFARSDHLKAHVQSLHSNKEHKCSLCEAAFSRLDALERHKVSK 552
             :.:||...:|         ..:||.                      |...:::||     .|.
  Fly   151 -IFKHKNPLIE---------TPSFAN----------------------ENLPNKVDA-----KSP 178

  Fly   553 HNGEGLEPGSELK-------------LQLAEHTCEYCSKRFSSKTYLRKHTLLHTDFLYACKTCD 604
            ..|..::.|::|:             |.||.......:...:.:|..:..:|:       |..|.
  Fly   179 KKGNFIQIGTDLRLLTTYPSIKVVKPLALAPEDVAAENVPPAKRTARKMQSLV-------CPKCG 236

  Fly   605 ETFRERAQLREHEKTHTGQRNFLCCICGDSFARNDYLRVHMR-RHNGEKPYKCRFCVKAFPRATD 668
            ..|:....|:.|...|||::||.|..|...|......|:|.| ||.||:|::|.||...|..:|.
  Fly   237 RVFKTPYNLKTHMVRHTGEKNFPCTFCDKRFVTKYLARLHERVRHMGEQPFECNFCSATFFTSTA 301

  Fly   669 LKVHERYHTGTKPNLCNTCGKSFHRAYNLTIHMRTHTGERPYKCDQCPKSFTQSNDLKAHIRRHT 733
            ...|||..                           |..:..|:||||.|.|.....|..|...|:
  Fly   302 KSSHERIR---------------------------HIRDLRYQCDQCTKRFNTKTCLNKHKFLHS 339

  Fly   734 G-ERYKCPHCDAYFLQLYNMRNHCMS-AHNK 762
            | :.:.|..|...|.:...:|:|..| ||.|
  Fly   340 GLKPFDCVICQINFARKATLRSHFDSVAHQK 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2202NP_572657.2 zf-AD 45..121 CDD:285071
C2H2 Zn finger 150..171 CDD:275368
C2H2 Zn finger 192..213 CDD:275370
C2H2 Zn finger 221..239 CDD:275370
COG5048 <443..730 CDD:227381 62/308 (20%)
C2H2 Zn finger 476..496 CDD:275368 2/19 (11%)
zf-H2C2_2 488..513 CDD:290200 4/24 (17%)
C2H2 Zn finger 504..525 CDD:275368 2/20 (10%)
C2H2 Zn finger 532..548 CDD:275368 3/15 (20%)
C2H2 Zn finger 573..593 CDD:275368 2/19 (11%)
C2H2 Zn finger 600..620 CDD:275368 5/19 (26%)
zf-H2C2_2 613..637 CDD:290200 10/23 (43%)
C2H2 Zn finger 628..648 CDD:275368 6/20 (30%)
zf-H2C2_2 640..663 CDD:290200 11/23 (48%)
C2H2 Zn finger 656..676 CDD:275368 8/19 (42%)
C2H2 Zn finger 684..704 CDD:275368 0/19 (0%)
zf-C2H2 684..704 CDD:278523 0/19 (0%)
zf-H2C2_2 696..721 CDD:290200 8/24 (33%)
C2H2 Zn finger 712..732 CDD:275368 8/19 (42%)
C2H2 Zn finger 739..755 CDD:275368 4/15 (27%)
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 13/38 (34%)
zf-C2H2 231..252 CDD:278523 5/27 (19%)
C2H2 Zn finger 232..252 CDD:275368 5/19 (26%)
zf-H2C2_2 244..269 CDD:290200 10/24 (42%)
C2H2 Zn finger 260..281 CDD:275368 6/20 (30%)
C2H2 Zn finger 289..308 CDD:275368 7/18 (39%)
C2H2 Zn finger 318..338 CDD:275368 8/19 (42%)
C2H2 Zn finger 346..362 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457862
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.