DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2202 and CG8301

DIOPT Version :9

Sequence 1:NP_572657.2 Gene:CG2202 / 32014 FlyBaseID:FBgn0030240 Length:889 Species:Drosophila melanogaster
Sequence 2:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster


Alignment Length:623 Identity:143/623 - (22%)
Similarity:223/623 - (35%) Gaps:194/623 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 CNTNPISSNEDDGEEANGANQTLWLHIKPEPCLEAEEVDLAMQ-----LKLEKKRRRREKAEAQA 351
            |.|..||....|.|  ||:|.:.:|.:....|..:|...:.:|     ||:.......:|..:..
  Fly     4 CRTCAISMFVCDFE--NGSNNSHFLDLHHPNCWPSEMAQIRLQFANWNLKISPNDGLPQKICSDC 66

  Fly   352 ETSIDRTVKNEHIAIGDSQFSIKE----------ENQLVGSDDEAPMGVEDFMKLHVS-GELPLS 405
            .|.. .::....:|..::|..:..          |:..:|.:|..|  .|:..:...: ....:|
  Fly    67 FTKF-CSINAFRLACQEAQLKLSHIYDKIDASSLEDDEIGQEDLEP--AEEHQETETTKPTTTVS 128

  Fly   406 DEERFDGFADD------DS-DLDDDDDDDDEEDAGDDDDGEFRLKQEPLDGEKPLKKAKSGRRRR 463
            .|.:.:..|.|      |: |:|:.:::::||:.....|.|.   :||:                
  Fly   129 AETQPNNTASDPIEIFVDAVDIDEAEEEEEEEEQQQQYDEEV---EEPI---------------- 174

  Fly   464 RRNKDEPNPDN-----RCEVC---QRTFSRHCHLLRH-KLSHLEKKPHNCPHCPKAFARSDHLKA 519
               .||..|..     .|:.|   |..:.....||.| ..||..::|:|||.|...|..:.....
  Fly   175 ---TDESAPPQLTISYACKFCLRPQENYQLQQLLLEHINASHDPEQPYNCPECEARFQDAASRTV 236

  Fly   520 HVQSLHSNKEHKCSLCEAAFSRLDALERHKVSKHNGEGLEPGSELKLQLAEHTCEYCSKRFSSKT 584
            |::|.|..|:|.|.:|...:.....| ||.|.|::.|            .:..|..|.|||.::.
  Fly   237 HLKSSHVEKQHACGVCGKKYGDRHNL-RHHVEKYHSE------------TDFECALCEKRFYTRK 288

  Fly   585 YLRKHTLLHT-DFLYACK--TCDETFRERAQLREHEKTHTG---QRNFLCCICGDSFARNDYLRV 643
            .|..|...|. |..:.|:  .|:..|..:..|..||.||:|   :::..|..||.:|.....||.
  Fly   289 SLNYHMKWHNPDRQFKCRHSGCERLFISQRHLMCHEATHSGTSSRKSEHCGFCGKTFIHLKTLRW 353

  Fly   644 HM-RRHNGEKPYKC--------------------------------------------------- 656
            |: |:|.|||||||                                                   
  Fly   354 HIYRQHGGEKPYKCANCTEVFASYAEKRIHMLERHRENLTAIERSECMLCRQPFSSEPDLIHHMS 418

  Fly   657 --------------------------------------RF------------------------C 659
                                                  ||                        |
  Fly   419 AEHLQRPGAPIIANNKRVLQQKRERQYSGLFQCGSCSQRFNMKSALERHAAVHSEKDRPHACPHC 483

  Fly   660 VKAFPRATDLKVHERYHTGTKPNLCNTCGKSFHRAYNLTIHMRTH-TGERPYKCDQCPKSFTQSN 723
            .|.|.||.|:|.|.:.|...|||:|:.|||:|...|.||.|..:| ..|:.:||:.|.:::....
  Fly   484 SKRFKRAQDMKWHIKTHEKEKPNVCDVCGKAFALKYVLTQHRLSHEVLEKNFKCNVCGRAYLFEK 548

  Fly   724 DLKAHIRRHTGER-YKCPHCDAYFLQLYNMRNHCMSAH 760
            .|:.|.|.|||:. |||..|...|:....::.|...||
  Fly   549 SLRLHQRTHTGKTYYKCDLCQERFVTHIKLKTHMQKAH 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2202NP_572657.2 zf-AD 45..121 CDD:285071
C2H2 Zn finger 150..171 CDD:275368
C2H2 Zn finger 192..213 CDD:275370
C2H2 Zn finger 221..239 CDD:275370
COG5048 <443..730 CDD:227381 96/416 (23%)
C2H2 Zn finger 476..496 CDD:275368 6/23 (26%)
zf-H2C2_2 488..513 CDD:290200 11/25 (44%)
C2H2 Zn finger 504..525 CDD:275368 6/20 (30%)
C2H2 Zn finger 532..548 CDD:275368 3/15 (20%)
C2H2 Zn finger 573..593 CDD:275368 7/19 (37%)
C2H2 Zn finger 600..620 CDD:275368 6/21 (29%)
zf-H2C2_2 613..637 CDD:290200 10/26 (38%)
C2H2 Zn finger 628..648 CDD:275368 8/20 (40%)
zf-H2C2_2 640..663 CDD:290200 16/136 (12%)
C2H2 Zn finger 656..676 CDD:275368 11/132 (8%)
C2H2 Zn finger 684..704 CDD:275368 9/19 (47%)
zf-C2H2 684..704 CDD:278523 9/19 (47%)
zf-H2C2_2 696..721 CDD:290200 8/25 (32%)
C2H2 Zn finger 712..732 CDD:275368 5/19 (26%)
C2H2 Zn finger 739..755 CDD:275368 3/15 (20%)
CG8301NP_649915.1 zf-AD 3..87 CDD:285071 19/85 (22%)
COG5048 198..>508 CDD:227381 72/322 (22%)
C2H2 Zn finger 221..241 CDD:275368 5/19 (26%)
C2H2 Zn finger 249..269 CDD:275368 6/20 (30%)
C2H2 Zn finger 277..297 CDD:275368 7/19 (37%)
C2H2 Zn finger 305..327 CDD:275368 6/21 (29%)
C2H2 Zn finger 338..359 CDD:275368 8/20 (40%)
C2H2 Zn finger 367..384 CDD:275368 1/16 (6%)
C2H2 Zn finger 400..420 CDD:275368 0/19 (0%)
C2H2 Zn finger 451..471 CDD:275368 2/19 (11%)
C2H2 Zn finger 480..500 CDD:275368 8/19 (42%)
C2H2 Zn finger 508..528 CDD:275368 9/19 (47%)
C2H2 Zn finger 537..557 CDD:275368 5/19 (26%)
C2H2 Zn finger 565..582 CDD:275368 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2264
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.