DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2202 and Neu2

DIOPT Version :9

Sequence 1:NP_572657.2 Gene:CG2202 / 32014 FlyBaseID:FBgn0030240 Length:889 Species:Drosophila melanogaster
Sequence 2:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster


Alignment Length:338 Identity:88/338 - (26%)
Similarity:139/338 - (41%) Gaps:68/338 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 DSDLDDDDDDDDEEDAGDDDDGEFRLKQEPLDGEKPLKKA---KSGRRRRRRNKDEPNPDNRCEV 478
            :.||.|..||.|..:..|.::.:.:.|::|........|:   ||..:...|:.....|.. |.:
  Fly    88 ERDLQDGADDVDSGNEPDINECDIKAKEKPGFSCSHCPKSFQVKSNLKVHMRSHTGERPFT-CSL 151

  Fly   479 CQRTFSRHCHLLRHKLSHLEKKPHNCPHCPKAFARSDHLKAHVQSLHSNKEHKCSLCEAAFSRLD 543
            |.::|.....|..|..:|..::|..|.|||::|....|||||:| :|   |.:.||         
  Fly   152 CPKSFGYSSGLQNHMRTHTGERPFQCSHCPRSFTAGHHLKAHIQ-MH---ERRGSL--------- 203

  Fly   544 ALERHKVSKHNGEGLEPGSELKLQLAEHTCEYCSKRFSSKTYLRKHTLLHTD-FLYACKTCDETF 607
                                        .|.||.|.|.:...|::|...||| ..:.|..|.::|
  Fly   204 ----------------------------RCPYCQKCFLTSLILKQHLATHTDETQFKCSQCSKSF 240

  Fly   608 RERAQLREHEKTHTGQRNFLCCICGDSFARNDYLRVHMRRH---------------NGEKPYKCR 657
            :...:|..|.:.|. :|.|.|..|...||.:.||:.|:.|:               ...|..||.
  Fly   241 QVEHELWMHMRVHQ-ERLFTCGHCSKDFALHAYLKRHLSRNARCSQSSKASAHKTLGHSKALKCG 304

  Fly   658 FCVKAFPRATDLKVHERYHTGTKPNLCNTCGKSFHRAYNLTIHMRTHTGERPYKCDQCPKSFTQS 722
            .|.|.|...:.|..|.:.||..||.|...|..|..:.      ..::...:|:||..||::|::.
  Fly   305 KCPKTFTDRSALSTHLKSHTKNKPLLEGPCKSSGSKP------AHSNAQRKPFKCSSCPRTFSRK 363

  Fly   723 NDLKAHIRRHTGE 735
            :.|..|::.|||:
  Fly   364 SALLTHLQTHTGK 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2202NP_572657.2 zf-AD 45..121 CDD:285071
C2H2 Zn finger 150..171 CDD:275368
C2H2 Zn finger 192..213 CDD:275370
C2H2 Zn finger 221..239 CDD:275370
COG5048 <443..730 CDD:227381 78/305 (26%)
C2H2 Zn finger 476..496 CDD:275368 5/19 (26%)
zf-H2C2_2 488..513 CDD:290200 9/24 (38%)
C2H2 Zn finger 504..525 CDD:275368 11/20 (55%)
C2H2 Zn finger 532..548 CDD:275368 2/15 (13%)
C2H2 Zn finger 573..593 CDD:275368 7/19 (37%)
C2H2 Zn finger 600..620 CDD:275368 5/19 (26%)
zf-H2C2_2 613..637 CDD:290200 8/23 (35%)
C2H2 Zn finger 628..648 CDD:275368 7/19 (37%)
zf-H2C2_2 640..663 CDD:290200 9/37 (24%)
C2H2 Zn finger 656..676 CDD:275368 6/19 (32%)
C2H2 Zn finger 684..704 CDD:275368 2/19 (11%)
zf-C2H2 684..704 CDD:278523 2/19 (11%)
zf-H2C2_2 696..721 CDD:290200 6/24 (25%)
C2H2 Zn finger 712..732 CDD:275368 6/19 (32%)
C2H2 Zn finger 739..755 CDD:275368
Neu2NP_649316.1 zf-AD 1..63 CDD:285071
COG5048 <119..241 CDD:227381 39/163 (24%)
C2H2 Zn finger 121..141 CDD:275368 4/19 (21%)
zf-H2C2_2 133..158 CDD:290200 5/25 (20%)
C2H2 Zn finger 149..169 CDD:275368 5/19 (26%)
zf-H2C2_2 162..185 CDD:290200 8/22 (36%)
C2H2 Zn finger 177..197 CDD:275368 11/20 (55%)
C2H2 Zn finger 205..225 CDD:275368 7/19 (37%)
zf-C2H2_8 206..286 CDD:292531 25/80 (31%)
C2H2 Zn finger 233..253 CDD:275368 5/19 (26%)
C2H2 Zn finger 260..297 CDD:275368 8/36 (22%)
C2H2 Zn finger 303..323 CDD:275368 6/19 (32%)
C2H2 Zn finger 353..373 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1382
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D42822at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.