DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2202 and CG17359

DIOPT Version :9

Sequence 1:NP_572657.2 Gene:CG2202 / 32014 FlyBaseID:FBgn0030240 Length:889 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster


Alignment Length:705 Identity:130/705 - (18%)
Similarity:180/705 - (25%) Gaps:387/705 - (54%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VDAERVCRV------CLKDVSLEGELHFIFNETPVEQDANLARILDECTLHQCERNDGMPPHMCS 98
            :|..::|||      ||.|:..|   .:..:....||:..||.:|.||:.....:.||||..:|.
  Fly     1 MDISQMCRVCRDESDCLLDIYTE---PYASSNRVQEQEPVLATMLRECSGCSVHKEDGMPQFICV 62

  Fly    99 SCVEAARNAYRFKRHAERSYCSLVALLGRSPQLKARGAEAASQTDQVALLPCEMCHDQFLNSLEL 163
            .|.||.|||||.:|...:|:                                             
  Fly    63 ECAEAVRNAYRLRRQCRKSH--------------------------------------------- 82

  Fly   164 RLHRNQVHRTTKEATSAGTDGLPSEDFKCKFCPQHFPHLRQLRSHLARSHEQTARLQCAHCQRTF 228
                                             |:|..||.:..                     
  Fly    83 ---------------------------------QYFEQLRLMMK--------------------- 93

  Fly   229 SRRDHLLRHIRNQHRDVEEDLLRTWPPADENTMNSDGGDELVSAEVLLNEEDN-EDEVVGEAFQC 292
                                                   ||...|..||..|| |.::.....:.
  Fly    94 ---------------------------------------ELDDIEYCLNIGDNIEPQMPVSVMEA 119

  Fly   293 NTNPISSNEDDGEEANGANQTLWLHIKPEPCLEAEEVDLAMQLKLEKKRRRREKAEAQAETSIDR 357
            ...|.:|                     ||.|    |:| :|:|.                    
  Fly   120 GKTPETS---------------------EPLL----VEL-VQVKY-------------------- 138

  Fly   358 TVKNEHIAIGDSQFSIKEENQLVGSDDEAPMGVEDFMKLHVSGELPLSDEERFDGFADDDSDLDD 422
                                                                             
  Fly   139 ----------------------------------------------------------------- 138

  Fly   423 DDDDDDEEDAGDDDDGEFRLKQEPLDGEKPLKKAKSGRRRRRRNKDEPNPDNRCEVCQRTFSRHC 487
                               :..||    ||:              ..|.|||.            
  Fly   139 -------------------MPPEP----KPI--------------SSPLPDNN------------ 154

  Fly   488 HLLRHKLSHLEKKPHNCPHCPKAFARSDHLKAHVQSLHSNKEHKCSLCEAAFSRLDALERHKVSK 552
               .|||:. ...|...||                    ||.                :|...|.
  Fly   155 ---EHKLAQ-SYSPAKTPH--------------------NKS----------------KRRARSY 179

  Fly   553 HNGEGLEPGSELKLQLAEHTCEYCSKRFSSKTYLRKHTLLHTDFLYACKTCDETFRERAQLREHE 617
            .:.:...|.|||     ||.                               |:.....|..|...
  Fly   180 SDNDSWSPDSEL-----EHE-------------------------------DDDKIWNASKRGKP 208

  Fly   618 KTHTGQRNFLCCICGDSFARNDYLRVHMRRHNGEKPYKCRFCVKAFPRATDLKVHERYHTGTKPN 682
            |...|.  :.|.:|..||.:...|.:|||.|.||:||||..|.::|.:..:|:.|.|.|||.:|.
  Fly   209 KRVPGP--YRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPF 271

  Fly   683 LCNTCGKSFHRAYNLTIHMRTHTGERPYKCDQCPKSFTQSNDLKAHIRRHT-GER 736
            .|..|.|.|.:...|.:|.||||||:|:||.:|.:||.|.|.|:.|:..|| |:|
  Fly   272 GCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGKR 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2202NP_572657.2 zf-AD 45..121 CDD:285071 29/81 (36%)
C2H2 Zn finger 150..171 CDD:275368 0/20 (0%)
C2H2 Zn finger 192..213 CDD:275370 4/20 (20%)
C2H2 Zn finger 221..239 CDD:275370 0/17 (0%)
COG5048 <443..730 CDD:227381 75/286 (26%)
C2H2 Zn finger 476..496 CDD:275368 3/19 (16%)
zf-H2C2_2 488..513 CDD:290200 6/24 (25%)
C2H2 Zn finger 504..525 CDD:275368 2/20 (10%)
C2H2 Zn finger 532..548 CDD:275368 0/15 (0%)
C2H2 Zn finger 573..593 CDD:275368 0/19 (0%)
C2H2 Zn finger 600..620 CDD:275368 4/19 (21%)
zf-H2C2_2 613..637 CDD:290200 7/23 (30%)
C2H2 Zn finger 628..648 CDD:275368 8/19 (42%)
zf-H2C2_2 640..663 CDD:290200 12/22 (55%)
C2H2 Zn finger 656..676 CDD:275368 6/19 (32%)
C2H2 Zn finger 684..704 CDD:275368 7/19 (37%)
zf-C2H2 684..704 CDD:278523 7/19 (37%)
zf-H2C2_2 696..721 CDD:290200 14/24 (58%)
C2H2 Zn finger 712..732 CDD:275368 8/19 (42%)
C2H2 Zn finger 739..755 CDD:275368
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 31/162 (19%)
zf-C2H2 215..237 CDD:278523 8/21 (38%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
zf-H2C2_2 229..254 CDD:290200 13/24 (54%)
C2H2 Zn finger 245..265 CDD:275368 6/19 (32%)
zf-H2C2_2 257..282 CDD:290200 11/24 (46%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 14/23 (61%)
C2H2 Zn finger 301..321 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457836
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.