DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2202 and Kah

DIOPT Version :9

Sequence 1:NP_572657.2 Gene:CG2202 / 32014 FlyBaseID:FBgn0030240 Length:889 Species:Drosophila melanogaster
Sequence 2:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster


Alignment Length:488 Identity:118/488 - (24%)
Similarity:171/488 - (35%) Gaps:150/488 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   439 EFRLKQEPL--DGEKPLKKAKSGRRRRRRNKDEPNPDNRCEVCQRTFSRHCHLLRHKLSHLEKKP 501
            |..|...||  |..|||....|       :.|:.|           :..|....|.||.......
  Fly    22 EVTLSVGPLVTDEVKPLPLYAS-------SDDDSN-----------YYSHKVFDRRKLRRCTISD 68

  Fly   502 HNCPHCPKAFARSDHLKAHVQSLHSNKEHKCSLCEAAFSRLDALERH-KVSKHNGEGLEPGSELK 565
            .|  .|..:.:.|      ..|..|:::|.            .|:.| .|..|:||..|..:...
  Fly    69 SN--SCASSSSSS------TSSRQSSEDHL------------GLQGHSSVHHHHGEQGEILNSTS 113

  Fly   566 LQLAEHTCEYCSKRFSSKTYLRKHTLLHTDFL----YACKTCDETFRERAQLREHEKTHTGQRNF 626
            |...||.|..|.|::|:.:.|.:|...|...:    ..|..|::.:........|.:||  .:..
  Fly   114 LLEDEHICPECGKKYSTSSNLARHRQTHRSIMDKKARHCPYCEKVYVSMPAYSMHVRTH--NQGC 176

  Fly   627 LCCICGDSFARNDYLRVHMRRHNGEKPYKCRFCVKAFPRATDLKVHERYHTGTKPNLCNTCGKSF 691
            .|..||..|:|...|:.|:|.|.||||:||..|.|||...::|:.|.:.|:.|||:.|..|||:|
  Fly   177 ECQFCGKRFSRPWLLQGHIRTHTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCARCGKAF 241

  Fly   692 HRAYNLTIHMRTH--------------TGERPYKCDQCPK------------------------- 717
            .....|..|..:.              :|.||   ...||                         
  Fly   242 ALKSYLYKHEESSCMKNRGGVPGSGAASGNRP---PSSPKRQQAEVTSGTISALAPGSPAAAVCA 303

  Fly   718 -----SFTQSNDL--KAHIRRHTGERYK----CPHCDAYFLQLYNMRNHCMSAHNKHIETKTGRL 771
                 ..|.:|.|  |...||.....::    .|...||        :|..||..::     .:.
  Fly   304 ASDSAKSTLANKLLQKEKDRRQAAMAFQGFPAGPEVTAY--------SHATSAQEEY-----EKF 355

  Fly   772 QRTGLLDDGGQSHLTTVVMP---PARY----PNELDPQLAATAA--------ATAAGGAESTSST 821
            :|..::.        ..|||   |:.|    ||...| ||...|        ||:.|.::.||  
  Fly   356 KRINVIQ--------PKVMPHRVPSLYQDLLPNRHVP-LALPLAMPYHFQGQATSTGQSDPTS-- 409

  Fly   822 TVIHSPGTYNATAAAPANTFDGANFTPTAVNTP 854
             |...|..:     :|.|     |||.:|..:|
  Fly   410 -VQEQPVDF-----SPKN-----NFTHSAKTSP 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2202NP_572657.2 zf-AD 45..121 CDD:285071
C2H2 Zn finger 150..171 CDD:275368
C2H2 Zn finger 192..213 CDD:275370
C2H2 Zn finger 221..239 CDD:275370
COG5048 <443..730 CDD:227381 82/339 (24%)
C2H2 Zn finger 476..496 CDD:275368 4/19 (21%)
zf-H2C2_2 488..513 CDD:290200 5/24 (21%)
C2H2 Zn finger 504..525 CDD:275368 3/20 (15%)
C2H2 Zn finger 532..548 CDD:275368 1/15 (7%)
C2H2 Zn finger 573..593 CDD:275368 6/19 (32%)
C2H2 Zn finger 600..620 CDD:275368 3/19 (16%)
zf-H2C2_2 613..637 CDD:290200 7/23 (30%)
C2H2 Zn finger 628..648 CDD:275368 8/19 (42%)
zf-H2C2_2 640..663 CDD:290200 12/22 (55%)
C2H2 Zn finger 656..676 CDD:275368 7/19 (37%)
C2H2 Zn finger 684..704 CDD:275368 7/19 (37%)
zf-C2H2 684..704 CDD:278523 7/19 (37%)
zf-H2C2_2 696..721 CDD:290200 7/68 (10%)
C2H2 Zn finger 712..732 CDD:275368 7/51 (14%)
C2H2 Zn finger 739..755 CDD:275368 3/15 (20%)
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 7/21 (33%)
C2H2 Zn finger 121..141 CDD:275368 6/19 (32%)
zf-C2H2 176..198 CDD:278523 8/21 (38%)
C2H2 Zn finger 178..198 CDD:275368 8/19 (42%)
zf-H2C2_2 191..214 CDD:290200 13/22 (59%)
zf-C2H2 204..226 CDD:278523 8/21 (38%)
C2H2 Zn finger 206..226 CDD:275368 7/19 (37%)
zf-H2C2_2 218..242 CDD:290200 10/23 (43%)
C2H2 Zn finger 234..250 CDD:275368 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.