DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG2202 and sna

DIOPT Version :9

Sequence 1:	NP_572657.2	Gene:	CG2202 / 32014	FlyBaseID:	FBgn0030240	Length:	889	Species:	Drosophila melanogaster
Sequence 2:	NP_476732.1	Gene:	sna / 34908	FlyBaseID:	FBgn0003448	Length:	390	Species:	Drosophila melanogaster

Alignment Length:	192	Identity:	56/192 - (29%)
Similarity:	79/192 - (41%)	Gaps:	59/192 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly   573 CEYCSKRFSSKTYLRKHTLLHTDFLYACKTCDETFRERAQLREHEKTHTGQRNFLCCICGDSFAR 637
            |:.|.|.:|:...|.||...|      |..        |:..:.:|||:
  Fly   247 CDECQKMYSTSMGLSKHRQFH------CPA--------AECNQEKKTHS---------------- 281

  Fly   638 NDYLRVHMRRHNGEKPYKCRFCVKAFPRATDLKVHERYHTGTKPNLCNTCGKSFHRAYNLTIHMR 702
                              |..|.|.:.....||:|.|.|  |.|..|..|||:|.|.:.|..|:|
  Fly   282 ------------------CEECGKLYTTIGALKMHIRTH--TLPCKCPICGKAFSRPWLLQGHIR 326

  Fly   703 THTGERPYKCDQCPKSFTQSNDLKAHIRRHTG-ERYKCPHCDAYFLQLYNMRNHCMSAHNKH 763
            |||||:|::|..||:||...::|:||.:.|.. ::|.|..|...|.:        ||..|||
  Fly   327 THTGEKPFQCPDCPRSFADRSNLRAHQQTHVDVKKYACQVCHKSFSR--------MSLLNKH 380

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG2202	NP_572657.2	zf-AD	45..121	CDD:285071
		C2H2 Zn finger	150..171	CDD:275368
		C2H2 Zn finger	192..213	CDD:275370
		C2H2 Zn finger	221..239	CDD:275370
		COG5048	<443..730	CDD:227381	46/156 (29%)
		C2H2 Zn finger	476..496	CDD:275368
		zf-H2C2_2	488..513	CDD:290200
		C2H2 Zn finger	504..525	CDD:275368
		C2H2 Zn finger	532..548	CDD:275368
		C2H2 Zn finger	573..593	CDD:275368	7/19 (37%)
		C2H2 Zn finger	600..620	CDD:275368	3/19 (16%)
		zf-H2C2_2	613..637	CDD:290200	3/23 (13%)
		C2H2 Zn finger	628..648	CDD:275368	0/19 (0%)
		zf-H2C2_2	640..663	CDD:290200	3/22 (14%)
		C2H2 Zn finger	656..676	CDD:275368	7/19 (37%)
		C2H2 Zn finger	684..704	CDD:275368	9/19 (47%)
		zf-C2H2	684..704	CDD:278523	9/19 (47%)
		zf-H2C2_2	696..721	CDD:290200	14/24 (58%)
		C2H2 Zn finger	712..732	CDD:275368	8/19 (42%)
		C2H2 Zn finger	739..755	CDD:275368	3/15 (20%)
sna	NP_476732.1	C2H2 Zn finger	308..328	CDD:275368	9/19 (47%)
		zf-H2C2_2	321..344	CDD:290200	13/22 (59%)
		zf-C2H2	334..356	CDD:278523	8/21 (38%)
		C2H2 Zn finger	336..356	CDD:275368	8/19 (42%)
		zf-H2C2_2	348..373	CDD:290200	8/24 (33%)
		C2H2 Zn finger	364..380	CDD:275368	6/23 (26%)
		C2H2 Zn finger	247..267	CDD:275368	7/19 (37%)
		C2H2 Zn finger	282..302	CDD:275368	7/19 (37%)
		zf-C2H2	306..328	CDD:278523	9/21 (43%)
		COG5048	307..>356	CDD:227381	23/48 (48%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24388
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100