DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2202 and Xaf1

DIOPT Version :9

Sequence 1:NP_572657.2 Gene:CG2202 / 32014 FlyBaseID:FBgn0030240 Length:889 Species:Drosophila melanogaster
Sequence 2:XP_006533630.1 Gene:Xaf1 / 327959 MGIID:3772572 Length:315 Species:Mus musculus


Alignment Length:178 Identity:42/178 - (23%)
Similarity:71/178 - (39%) Gaps:51/178 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   573 CEYCSKRFSSKTYLRKHTLLH----TDFLYACKTCDETFRERAQLREHEKTHTGQRNFLCCICGD 633
            |..|.:..:|     .|.:||    ..|:..|..|:|...| ::::||.:.              
Mouse     8 CRNCKRNVAS-----LHFMLHEAHCLRFIVLCPECEEPIPE-SKMKEHMEV-------------- 52

  Fly   634 SFARNDYLRVHMR-RHNGEKPYKCRFCVKAFPRATDLKVHERYHTGTKPNLCNTCGK-------S 690
                     ||.: :.:.:.|.||:||..|. :.::|.|||. |.|::...|..|.:       |
Mouse    53 ---------VHQQTKESQQHPAKCKFCELAV-QLSNLDVHES-HCGSRTEHCPHCNQPITLQVLS 106

  Fly   691 FHRAYNLTIHMRTHTGE-------RPYKCDQCPKSFTQSNDLKAHIRR 731
            .|:|..|:...|...|:       |..:||.| |.....|...:|:::
Mouse   107 QHKAMCLSAKGRPEEGKRIVSSPGRKTRCDLC-KQMIPENTYASHMKQ 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2202NP_572657.2 zf-AD 45..121 CDD:285071
C2H2 Zn finger 150..171 CDD:275368
C2H2 Zn finger 192..213 CDD:275370
C2H2 Zn finger 221..239 CDD:275370
COG5048 <443..730 CDD:227381 42/175 (24%)
C2H2 Zn finger 476..496 CDD:275368
zf-H2C2_2 488..513 CDD:290200
C2H2 Zn finger 504..525 CDD:275368
C2H2 Zn finger 532..548 CDD:275368
C2H2 Zn finger 573..593 CDD:275368 4/19 (21%)
C2H2 Zn finger 600..620 CDD:275368 6/19 (32%)
zf-H2C2_2 613..637 CDD:290200 2/23 (9%)
C2H2 Zn finger 628..648 CDD:275368 2/20 (10%)
zf-H2C2_2 640..663 CDD:290200 7/23 (30%)
C2H2 Zn finger 656..676 CDD:275368 8/19 (42%)
C2H2 Zn finger 684..704 CDD:275368 7/26 (27%)
zf-C2H2 684..704 CDD:278523 7/26 (27%)
zf-H2C2_2 696..721 CDD:290200 8/31 (26%)
C2H2 Zn finger 712..732 CDD:275368 6/20 (30%)
C2H2 Zn finger 739..755 CDD:275368
Xaf1XP_006533630.1 PLN03086 <1..108 CDD:178635 30/130 (23%)
XAF1_C 228..>260 CDD:376034
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S9797
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.