Sequence 1: | NP_572657.2 | Gene: | CG2202 / 32014 | FlyBaseID: | FBgn0030240 | Length: | 889 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001100721.1 | Gene: | Fezf2 / 305719 | RGDID: | 1311068 | Length: | 455 | Species: | Rattus norvegicus |
Alignment Length: | 242 | Identity: | 84/242 - (34%) |
---|---|---|---|
Similarity: | 123/242 - (50%) | Gaps: | 23/242 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 493 KLSHL--EKKPHNCPHCPKAFARSDHLKAHVQSLHSNKEHKCSLCEAAFSRLDALERHKVSKHNG 555
Fly 556 EGLEPGSELKLQLAEHTCEYCSKRFSSKTYLRKHTLLHTDFL-YACKTCDETFRERAQLREHEKT 619
Fly 620 HTGQRNFLCCICGDSFARNDYLRVHMRRHNGEKPYKCRFCVKAFPRATDLKVHERYHTGTKPNLC 684
Fly 685 NTCGKSFHRAYNLTIHMRTHTGERPYKCDQCPKSFTQSNDLKAHIRR 731 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2202 | NP_572657.2 | zf-AD | 45..121 | CDD:285071 | |
C2H2 Zn finger | 150..171 | CDD:275368 | |||
C2H2 Zn finger | 192..213 | CDD:275370 | |||
C2H2 Zn finger | 221..239 | CDD:275370 | |||
COG5048 | <443..730 | CDD:227381 | 83/239 (35%) | ||
C2H2 Zn finger | 476..496 | CDD:275368 | 2/2 (100%) | ||
zf-H2C2_2 | 488..513 | CDD:290200 | 7/21 (33%) | ||
C2H2 Zn finger | 504..525 | CDD:275368 | 3/20 (15%) | ||
C2H2 Zn finger | 532..548 | CDD:275368 | 4/15 (27%) | ||
C2H2 Zn finger | 573..593 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 600..620 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 613..637 | CDD:290200 | 8/23 (35%) | ||
C2H2 Zn finger | 628..648 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 640..663 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 656..676 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 684..704 | CDD:275368 | 11/19 (58%) | ||
zf-C2H2 | 684..704 | CDD:278523 | 11/19 (58%) | ||
zf-H2C2_2 | 696..721 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 712..732 | CDD:275368 | 9/20 (45%) | ||
C2H2 Zn finger | 739..755 | CDD:275368 | |||
Fezf2 | NP_001100721.1 | C2H2 Zn finger | 274..294 | CDD:275368 | 7/19 (37%) |
COG5048 | <284..>390 | CDD:227381 | 36/105 (34%) | ||
C2H2 Zn finger | 302..322 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 317..339 | CDD:404364 | 7/21 (33%) | ||
C2H2 Zn finger | 330..350 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 358..378 | CDD:275368 | 7/19 (37%) | ||
SFP1 | <380..436 | CDD:227516 | 25/54 (46%) | ||
C2H2 Zn finger | 386..406 | CDD:275368 | 11/19 (58%) | ||
C2H2 Zn finger | 414..432 | CDD:275368 | 8/17 (47%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24388 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |