DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2202 and Fezf2

DIOPT Version :9

Sequence 1:NP_572657.2 Gene:CG2202 / 32014 FlyBaseID:FBgn0030240 Length:889 Species:Drosophila melanogaster
Sequence 2:NP_001100721.1 Gene:Fezf2 / 305719 RGDID:1311068 Length:455 Species:Rattus norvegicus


Alignment Length:242 Identity:84/242 - (34%)
Similarity:123/242 - (50%) Gaps:23/242 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   493 KLSHL--EKKPHNCPHCPKAFARSDHLKAHVQSLHSNKEHKCSLCEAAFSRLDALERHKVSKHNG 555
            ||:.|  :|.||     |.::...:.|.|.::.:  .||:         |.|.| ||..|..|: 
  Rat   212 KLASLTADKFPH-----PASYPHKERLHAPLEQV--LKEN---------SALTA-ERGGVKSHS- 258

  Fly   556 EGLEPGSELKLQLAEHTCEYCSKRFSSKTYLRKHTLLHTDFL-YACKTCDETFRERAQLREHEKT 619
              ..||.....:....|||.|.|.|::...|.:|..:||... :.||.|.:.||:.:.|..|:..
  Rat   259 --KLPGGSTDSKPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKII 321

  Fly   620 HTGQRNFLCCICGDSFARNDYLRVHMRRHNGEKPYKCRFCVKAFPRATDLKVHERYHTGTKPNLC 684
            ||.::...|..||.:|.|:..|..|:|.|.|.||:.|.||.|.|.:..:.|.|:..|:|.|...|
  Rat   322 HTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKC 386

  Fly   685 NTCGKSFHRAYNLTIHMRTHTGERPYKCDQCPKSFTQSNDLKAHIRR 731
            ..|.|:||:.||||.||.||..::|:.|..|.|.|.::.|||.|:|:
  Rat   387 TICNKAFHQVYNLTFHMHTHNDKKPFTCATCGKGFCRNFDLKKHVRK 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2202NP_572657.2 zf-AD 45..121 CDD:285071
C2H2 Zn finger 150..171 CDD:275368
C2H2 Zn finger 192..213 CDD:275370
C2H2 Zn finger 221..239 CDD:275370
COG5048 <443..730 CDD:227381 83/239 (35%)
C2H2 Zn finger 476..496 CDD:275368 2/2 (100%)
zf-H2C2_2 488..513 CDD:290200 7/21 (33%)
C2H2 Zn finger 504..525 CDD:275368 3/20 (15%)
C2H2 Zn finger 532..548 CDD:275368 4/15 (27%)
C2H2 Zn finger 573..593 CDD:275368 7/19 (37%)
C2H2 Zn finger 600..620 CDD:275368 7/19 (37%)
zf-H2C2_2 613..637 CDD:290200 8/23 (35%)
C2H2 Zn finger 628..648 CDD:275368 8/19 (42%)
zf-H2C2_2 640..663 CDD:290200 11/22 (50%)
C2H2 Zn finger 656..676 CDD:275368 7/19 (37%)
C2H2 Zn finger 684..704 CDD:275368 11/19 (58%)
zf-C2H2 684..704 CDD:278523 11/19 (58%)
zf-H2C2_2 696..721 CDD:290200 12/24 (50%)
C2H2 Zn finger 712..732 CDD:275368 9/20 (45%)
C2H2 Zn finger 739..755 CDD:275368
Fezf2NP_001100721.1 C2H2 Zn finger 274..294 CDD:275368 7/19 (37%)
COG5048 <284..>390 CDD:227381 36/105 (34%)
C2H2 Zn finger 302..322 CDD:275368 7/19 (37%)
zf-H2C2_2 317..339 CDD:404364 7/21 (33%)
C2H2 Zn finger 330..350 CDD:275368 8/19 (42%)
C2H2 Zn finger 358..378 CDD:275368 7/19 (37%)
SFP1 <380..436 CDD:227516 25/54 (46%)
C2H2 Zn finger 386..406 CDD:275368 11/19 (58%)
C2H2 Zn finger 414..432 CDD:275368 8/17 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.