DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17333 and PGL2

DIOPT Version :9

Sequence 1:NP_572656.1 Gene:CG17333 / 32013 FlyBaseID:FBgn0030239 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_190505.1 Gene:PGL2 / 824098 AraportID:AT3G49360 Length:259 Species:Arabidopsis thaliana


Alignment Length:241 Identity:80/241 - (33%)
Similarity:117/241 - (48%) Gaps:46/241 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QLVQALGDLLQR-CSQEALAKHDKFSVGLSGGSLVQLLTKALKS---CNLKTAKWVFFFCDERYV 78
            :|.:...||..: |.:..:     |:|.||||.|:..|.|.|::   .:::.:||..|:.|||..
plant    18 ELAKYTADLSSKFCKERGV-----FTVVLSGGDLIAWLWKLLEAPYIDSIEWSKWHIFWVDERVC 77

  Fly    79 RLDDSDSTYGAYRAEWLTQLPCIQESQF-----VRADTSQPLDACAADYEAKVKSQVD------- 131
            ..|.:||.|......:|:::|...|:.:     :.|:.:..|  .|..||..:|.:|:       
plant    78 AWDHADSNYKLAYDGFLSKVPVPAENIYAIDNGLGAEGNAEL--AAERYEECLKQKVNQNIIRTY 140

  Fly   132 ------RFDLLLLGMGPDGHTCSLFPEQPATLQETKRLVIPIRNSPKPPPERITFTLPLINKARN 190
                  :|||.|||||||||..||||.. |.:.|..:.|..|.:|||||.:|||.|||:||.|..
plant   141 KSSGFPQFDLQLLGMGPDGHMASLFPGH-AQINEKVKWVTSITDSPKPPSKRITLTLPVINCASY 204

  Fly   191 VAFVVTGAAKASVVKSVFVDLDKKFPAAWVNPTK----GQLTLIVD 232
            ....|....:|..|            ||.:|.||    |:||..|:
plant   205 NVMAVCDKEQADSV------------AAALNHTKDLPAGRLTADVE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17333NP_572656.1 Glucosamine_iso 14..228 CDD:279517 77/235 (33%)
PGL2NP_190505.1 SugarP_isomerase 7..251 CDD:412321 80/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1806
eggNOG 1 0.900 - - E1_COG0363
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I1873
OMA 1 1.010 - - QHG62685
OrthoDB 1 1.010 - - D1420529at2759
OrthoFinder 1 1.000 - - FOG0001920
OrthoInspector 1 1.000 - - otm2418
orthoMCL 1 0.900 - - OOG6_101429
Panther 1 1.100 - - O PTHR11054
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1274
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.