DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17333 and Pgls

DIOPT Version :9

Sequence 1:NP_572656.1 Gene:CG17333 / 32013 FlyBaseID:FBgn0030239 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_079672.1 Gene:Pgls / 66171 MGIID:1913421 Length:257 Species:Mus musculus


Alignment Length:235 Identity:99/235 - (42%)
Similarity:144/235 - (61%) Gaps:13/235 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ASEEQLVQALGDLL-QRCSQEALAKHDKFSVGLSGGSLVQLLTKALKSCNLKT-----AKWVFFF 72
            :|.::|..:|..|: ||.:........:|::||||||||.:|.:.|.:.....     |:|...|
Mouse    13 SSPQELGASLAQLVAQRAASCLEGDRGRFALGLSGGSLVSMLARDLPAAAAPAGPASFARWTLGF 77

  Fly    73 CDERYVRLDDSDSTYGAYRAEWLTQLPCIQESQFVRADTSQPLDACAADYEAKVK-----SQVDR 132
            ||||.|..|.::||||.||...|::|| |.:||.:..:.:.|::..|.||..|::     ..|..
Mouse    78 CDERLVPFDHAESTYGLYRTHLLSKLP-IPDSQVLTINPALPVEDAAEDYARKLRQALQGDAVPV 141

  Fly   133 FDLLLLGMGPDGHTCSLFPEQPATLQETKRLVIPIRNSPKPPPERITFTLPLINKARNVAFVVTG 197
            ||||:||:|||||||||||:.| .|||.:::|.||.:||||||:|:|.|||::|.|:::.||.||
Mouse   142 FDLLILGVGPDGHTCSLFPDHP-LLQEREKIVAPISDSPKPPPQRVTLTLPVLNAAQSIIFVATG 205

  Fly   198 AAKASVVKSVFVDLDKKFPAAWVNPTKGQLTLIVDAGAGK 237
            ..||:|:|.:..|.:...|||.|.|..|.|...:|..|.:
Mouse   206 EGKAAVLKRILEDKEGTLPAALVQPRTGALCWFLDEAAAR 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17333NP_572656.1 Glucosamine_iso 14..228 CDD:279517 96/224 (43%)
PglsNP_079672.1 pgl 11..247 CDD:273494 99/235 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832390
Domainoid 1 1.000 176 1.000 Domainoid score I3615
eggNOG 1 0.900 - - E1_COG0363
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6037
Inparanoid 1 1.050 180 1.000 Inparanoid score I3989
Isobase 1 0.950 - 0 Normalized mean entropy S1649
OMA 1 1.010 - - QHG62685
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001920
OrthoInspector 1 1.000 - - oto94121
orthoMCL 1 0.900 - - OOG6_101429
Panther 1 1.100 - - LDO PTHR11054
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5
SonicParanoid 1 1.000 - - X1274
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.