DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17333 and gnpda1

DIOPT Version :9

Sequence 1:NP_572656.1 Gene:CG17333 / 32013 FlyBaseID:FBgn0030239 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001017867.1 Gene:gnpda1 / 550565 ZFINID:ZDB-GENE-050417-417 Length:269 Species:Danio rerio


Alignment Length:234 Identity:58/234 - (24%)
Similarity:100/234 - (42%) Gaps:46/234 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSVGLSGGSLVQLLTKALKSCNLK---TAKWVFFFCDERYVRLD-DSDSTYGAYRAEWLTQLPCI 101
            |::||..||......|.|...:.|   :.::|..|..:.||.|. |...:|.::.  |......|
Zfish    35 FTLGLPTGSTPLGCYKKLIEYHKKGEISFQYVKTFNMDEYVGLPRDHPESYHSFM--WNNFFKHI 97

  Fly   102 QESQFVRADTSQPLDACA-------ADYEAKVKSQVDRFDLLLLGMGPDGHTCSLFPEQPATL-- 157
            .    :||:.:..||..|       .|:|||:|: ....:|.:.|:|||||..  |.|..::|  
Zfish    98 D----IRAENAHILDGNAPNLEKECQDFEAKIKA-AGGIELFVGGIGPDGHIA--FNEPGSSLVS 155

  Fly   158 -QETKRLVIP--IRNS-------PKPPPERITFTLPLINKARNVAFVVTGAAKASVVKSVFVDLD 212
             ...|.|.:.  :.|:       .|.|...:|..:..:..||.|..::||:.||.   :::..::
Zfish   156 RTRVKTLAMDTILANARFFDGDLSKVPTMALTVGVGTVMDAREVMILITGSHKAF---ALYKAIE 217

  Fly   213 KKFPAAWV------NPTKGQLTLIVDAGAGKE--IETLK 243
            :.....|.      :|   |...:.|..|.:|  ::|:|
Zfish   218 EGVNHMWTVSAFQQHP---QTVFVCDEDATQELRVKTVK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17333NP_572656.1 Glucosamine_iso 14..228 CDD:279517 53/215 (25%)
gnpda1NP_001017867.1 nagB 1..258 CDD:179028 58/234 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.