DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17333 and pgls

DIOPT Version :9

Sequence 1:NP_572656.1 Gene:CG17333 / 32013 FlyBaseID:FBgn0030239 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001184018.1 Gene:pgls / 548361 XenbaseID:XB-GENE-986750 Length:247 Species:Xenopus tropicalis


Alignment Length:233 Identity:105/233 - (45%)
Similarity:141/233 - (60%) Gaps:13/233 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ASEEQLVQALGDLLQRCSQEALAKHDKFSVGLSGGSLVQLLTKAL-KSCNLKTAKWVFFFCDERY 77
            :|..:|..:|..||...||...:    |.:.||||||||||::.| |:..|.||.|...|||||.
 Frog    11 SSPAELALSLTQLLVHESQGTCS----FRLALSGGSLVQLLSRELPKTAGLNTAGWKVAFCDERL 71

  Fly    78 VRLDDSDSTYGAYRAEWLTQLPCIQESQFVRADTSQPLDACAADYEAKVKSQVDR-----FDLLL 137
            |...|.:||||.|:.: |..|..:.|||||..|.:.|::..|.||..||:.....     |||::
 Frog    72 VPFSDPESTYGEYKRQ-LVPLGLLSESQFVTIDPALPVEEAAVDYTKKVRELFPGDDHPVFDLVI 135

  Fly   138 LGMGPDGHTCSLFPEQPATLQETKRLVIPIRNSPKPPPERITFTLPLINKARNVAFVVTGAAKAS 202
            ||:||||||.||||..| .||.|.::|.||.:||||||:|:|.|||:||.|:.|.||.||..||:
 Frog   136 LGIGPDGHTASLFPGHP-LLQVTDKVVAPISDSPKPPPQRVTLTLPVINAAKTVVFVATGEGKAA 199

  Fly   203 VVKSVFVDLDK-KFPAAWVNPTKGQLTLIVDAGAGKEI 239
            |:|.:..:.:. ..|||.|:|..|:|...:|..|.:|:
 Frog   200 VLKRILQEEESDPLPAARVSPVHGKLLWFLDEPAAREL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17333NP_572656.1 Glucosamine_iso 14..228 CDD:279517 101/220 (46%)
pglsNP_001184018.1 6PGL 14..229 CDD:238694 101/220 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I3746
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6037
Inparanoid 1 1.050 176 1.000 Inparanoid score I3931
OMA 1 1.010 - - QHG62685
OrthoDB 1 1.010 - - D1420529at2759
OrthoFinder 1 1.000 - - FOG0001920
OrthoInspector 1 1.000 - - oto104329
Panther 1 1.100 - - LDO PTHR11054
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1274
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.