DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17333 and Oscillin

DIOPT Version :9

Sequence 1:NP_572656.1 Gene:CG17333 / 32013 FlyBaseID:FBgn0030239 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001245894.1 Gene:Oscillin / 33783 FlyBaseID:FBgn0031717 Length:273 Species:Drosophila melanogaster


Alignment Length:192 Identity:45/192 - (23%)
Similarity:73/192 - (38%) Gaps:48/192 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSVGLSGGSLVQLLTKALKSCNLKTAKWVFFFCDERYVRLDDSDSTYGAYRAE--------WLTQ 97
            |.:||..||....:.|.|...: |..|..|     :||:..:.|...|..|..        |   
  Fly    35 FVLGLPTGSTPLGMYKELIEFH-KQGKVSF-----QYVKTFNMDEYVGLARDHHESYHYFMW--- 90

  Fly    98 LPCIQESQFVRADTSQP-----LDACAADYEAKVKSQVDRF------DLLLLGMGPDGHTCSLFP 151
                  :.|.:....:|     ||..|||..|:.....|:.      :|.:.|:|||||..  |.
  Fly    91 ------NNFFKHIDIEPKNVHILDGNAADLVAECNKFEDQIREAGGVELFIGGIGPDGHIA--FN 147

  Fly   152 EQPATLQETKRLVIPIRNS------------PKPPPERITFTLPLINKARNVAFVVTGAAKA 201
            |..::|....|:....:::            .|.|.:.:|..:..:..::.|..::|||.||
  Fly   148 EPGSSLVSRTRVKTLAQDTLEANARFFDNDMSKVPKQALTVGVGTVMDSKEVMILITGAHKA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17333NP_572656.1 Glucosamine_iso 14..228 CDD:279517 45/192 (23%)
OscillinNP_001245894.1 SugarP_isomerase 1..253 CDD:294243 45/192 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0363
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.