DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17333 and H6pd

DIOPT Version :9

Sequence 1:NP_572656.1 Gene:CG17333 / 32013 FlyBaseID:FBgn0030239 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001100168.1 Gene:H6pd / 298655 RGDID:1306562 Length:797 Species:Rattus norvegicus


Alignment Length:235 Identity:77/235 - (32%)
Similarity:120/235 - (51%) Gaps:21/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SASEEQLVQALGDLLQRCSQEALAKHDKFSVGLSGGSLVQLLTKALKSCNLKTAKWVF---FFCD 74
            :|..|:|:..|.:.::..:.:|:.:..||.:.|||||....|.:.|.:.:. :..|.:   :..|
  Rat   563 TAWPEELISKLANDIEAAAVQAVRRFGKFHLALSGGSSPIALFQQLATGHY-SFPWAYTHLWLVD 626

  Fly    75 ERYVRLDDSDSTYGAYRAEWLTQ----------LPCIQESQFVRADTSQPLDACAADYEAKVKSQ 129
            ||.|.|.|.||.:...:|..|..          :| :...|.:.|:..|.....|::..|.|.: 
  Rat   627 ERCVPLSDPDSNFQGLQAHLLQHVRVPYYNIHPMP-VHLHQRLCAEEDQGAQTYASEISALVAN- 689

  Fly   130 VDRFDLLLLGMGPDGHTCSLFPEQPATLQETKRLVIPIRNSPKPPPERITFTLPLINKARNVAFV 194
             ..|||:|||||.||||.||||:.|..| :..:||: :..||..|.:|::.:|||||:|:.||.:
  Rat   690 -SSFDLVLLGMGTDGHTASLFPQSPRGL-DGDQLVV-LTESPFRPHQRMSLSLPLINRAKKVAVL 751

  Fly   195 VTGAAKASVVKSV--FVDLDKKFPAAWVNPTKGQLTLIVD 232
            |.|..|..:...|  .....||:|.:.|.|..|||...:|
  Rat   752 VMGRTKREITTLVSRVGHEPKKWPISGVVPLSGQLVWYMD 791

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17333NP_572656.1 Glucosamine_iso 14..228 CDD:279517 75/228 (33%)
H6pdNP_001100168.1 Zwf 27..510 CDD:223441
G6PD_N 34..216 CDD:278882
G6PD_C 230..517 CDD:280876
pgl 562..797 CDD:273494 77/235 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0363
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.