DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17333 and Gnpda1

DIOPT Version :9

Sequence 1:NP_572656.1 Gene:CG17333 / 32013 FlyBaseID:FBgn0030239 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_036067.2 Gene:Gnpda1 / 26384 MGIID:1347054 Length:289 Species:Mus musculus


Alignment Length:214 Identity:55/214 - (25%)
Similarity:92/214 - (42%) Gaps:47/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LLQRCSQ--EALAKH------------DK-FSVGLSGGS----LVQLLTKALKSCNLKTAKWVFF 71
            :|:..||  |..||:            || |::||..||    ..|.|.:..|:.:| :.::|..
Mouse     5 ILEHYSQASEWAAKYIRNRIIQFNPGPDKYFTLGLPTGSTPLGCYQKLIEYYKNGDL-SFQYVKT 68

  Fly    72 FCDERYVRLD-DSDSTYGAYRAEWLTQLPCIQESQFVRADTSQPLDACAADYEAKVKSQVDR--- 132
            |..:.||.|. |...:|.::.  |......|.    :..:.:..||..|||.:|:..:..::   
Mouse    69 FNMDEYVGLPRDHPESYHSFM--WNNFFKHID----IHPENTHILDGNAADLQAECDAFEEKIQA 127

  Fly   133 ---FDLLLLGMGPDGHTCSLFPEQPATL---QETKRLVIP--IRNS-------PKPPPERITFTL 182
               .:|.:.|:|||||..  |.|..::|   ...|.|.:.  :.|:       .|.|...:|..:
Mouse   128 AGGIELFVGGIGPDGHIA--FNEPGSSLVSRTRVKTLAMDTILANARFFDGDLAKVPTMALTVGV 190

  Fly   183 PLINKARNVAFVVTGAAKA 201
            ..:..|:.|..::|||.||
Mouse   191 GTVMDAKEVMILITGAHKA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17333NP_572656.1 Glucosamine_iso 14..228 CDD:279517 55/214 (26%)
Gnpda1NP_036067.2 SugarP_isomerase 1..253 CDD:294243 55/214 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0363
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.