DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17333 and SPCC16C4.10

DIOPT Version :9

Sequence 1:NP_572656.1 Gene:CG17333 / 32013 FlyBaseID:FBgn0030239 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_587920.1 Gene:SPCC16C4.10 / 2538922 PomBaseID:SPCC16C4.10 Length:257 Species:Schizosaccharomyces pombe


Alignment Length:260 Identity:96/260 - (36%)
Similarity:137/260 - (52%) Gaps:40/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SASEEQLV-QALGDLLQRCSQEALAKHDKFSVGLSGGSLVQLLTKAL-KSCNLKTAKWVFFFCDE 75
            |.|:..|| :|||..::..|:.::.:|..|::.||||||.::|.:.| :...::.:||..||.||
pombe     5 SFSDVSLVAKALGAFVKEKSEASIKRHGVFTLALSGGSLPKVLAEGLAQQRGIEFSKWEVFFADE 69

  Fly    76 RYVRLDDSDSTYGAYRAEWLTQLPCIQESQFVRADTSQ------------PLDA--CAADYEAKV 126
            |.|.|||.:|.|...:.        :...:|...|..:            |:|.  .|.:||.::
pombe    70 RIVPLDDENSNYALCKK--------LIFDKFEGFDPKKIHTINPELLKENPIDPQNVADEYEKQL 126

  Fly   127 --------KSQVDRFDLLLLGMGPDGHTCSLFPEQPATLQETKRLVIPIRNSPKPPPERITFTLP 183
                    ..:|..|||||||.|||||||||||:. ..|||....|.|:.:|||||.:|||.|||
pombe   127 VHVFANSSTVKVPVFDLLLLGCGPDGHTCSLFPDH-EVLQEDVAWVAPVTDSPKPPKDRITLTLP 190

  Fly   184 LINKARNVAFVVTGAAKASVVKSVFVDLDKKFPAAWVNPTKGQLT---LIVD--AGAGKEIETLK 243
            ::..|:.:|||.|||.|..::..|..|...|.|:|.:  |:..||   ..||  |.|..|..:||
pombe   191 VVTHAQAIAFVTTGAGKKDILPIVIEDFTSKLPSALI--TRNNLTRTSWFVDDEASANLERSSLK 253

  Fly   244  243
            pombe   254  253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17333NP_572656.1 Glucosamine_iso 14..228 CDD:279517 86/237 (36%)
SPCC16C4.10NP_587920.1 6PGL 12..239 CDD:238694 86/237 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 133 1.000 Domainoid score I1302
eggNOG 1 0.900 - - E1_COG0363
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6037
Inparanoid 1 1.050 135 1.000 Inparanoid score I1401
OMA 1 1.010 - - QHG62685
OrthoFinder 1 1.000 - - FOG0001920
OrthoInspector 1 1.000 - - oto101545
orthoMCL 1 0.900 - - OOG6_101429
Panther 1 1.100 - - LDO PTHR11054
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5
SonicParanoid 1 1.000 - - X1274
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.