DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17333 and GNPDA2

DIOPT Version :9

Sequence 1:NP_572656.1 Gene:CG17333 / 32013 FlyBaseID:FBgn0030239 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_612208.1 Gene:GNPDA2 / 132789 HGNCID:21526 Length:276 Species:Homo sapiens


Alignment Length:185 Identity:50/185 - (27%)
Similarity:79/185 - (42%) Gaps:34/185 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSVGLSGGS----LVQLLTKALKSCNLKTAKWVFFFCDERYVRLD-DSDSTYGAYRAEWLTQLPC 100
            |::||..||    ..:.|.:..|:.:| :.|:|..|..:.||.|. :...:|.:|.  |......
Human    35 FTLGLPTGSTPLGCYKKLIEYHKNGHL-SFKYVKTFNMDEYVGLPRNHPESYHSYM--WNNFFKH 96

  Fly   101 IQESQFVRADTSQPLDACAAD-------YEAKVKSQVDRFDLLLLGMGPDGHTCSLFPEQPATLQ 158
            |.    :..:.:..||..|||       :|.|:| :....||.:.|:|||||..  |.|..::|.
Human    97 ID----IDPNNAHILDGNAADLQAECDAFENKIK-EAGGIDLFVGGIGPDGHIA--FNEPGSSLV 154

  Fly   159 ETKRLVIPIRNS------------PKPPPERITFTLPLINKARNVAFVVTGAAKA 201
            ...||.....::            .|.|...:|..:..:..||.|..::|||.||
Human   155 SRTRLKTLAMDTILANAKYFDGDLSKVPTMALTVGVGTVMDAREVMILITGAHKA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17333NP_572656.1 Glucosamine_iso 14..228 CDD:279517 50/185 (27%)
GNPDA2NP_612208.1 SugarP_isomerase 1..253 CDD:381958 50/185 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0363
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.