DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17333 and H6pd

DIOPT Version :9

Sequence 1:NP_572656.1 Gene:CG17333 / 32013 FlyBaseID:FBgn0030239 Length:243 Species:Drosophila melanogaster
Sequence 2:XP_006538521.1 Gene:H6pd / 100198 MGIID:2140356 Length:826 Species:Mus musculus


Alignment Length:236 Identity:79/236 - (33%)
Similarity:116/236 - (49%) Gaps:23/236 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SASEEQLVQALGDLLQRCSQEALAKHDKFSVGLSGGS-----LVQLLTKALKSCNLKTAKWVFFF 72
            :|..|:|:..|...::..:.:|:....||.:.|||||     ..||.|.........|..|:   
Mouse   592 TAWPEELISKLASDIEAAAVQAVRHFGKFHLALSGGSSPIALFQQLATGHYSFPWAHTHLWL--- 653

  Fly    73 CDERYVRLDDSDSTYGAYRAEWL--TQLPC-------IQESQFVRADTSQPLDACAADYEAKVKS 128
            .|||.|.|.|.||.:...:|..|  .::|.       :...|.:.|:..|.....|::..|.|.:
Mouse   654 VDERCVPLSDPDSNFQGLQAHLLQHVRVPYYNIHPMPVHLHQRLCAEEDQGAQTYASEISALVAN 718

  Fly   129 QVDRFDLLLLGMGPDGHTCSLFPEQPATLQETKRLVIPIRNSPKPPPERITFTLPLINKARNVAF 193
              ..|||:|||||.||||.||||:.|..| :..:||: :..||..|.:|::.:|||||:|:.||.
Mouse   719 --SSFDLVLLGMGTDGHTASLFPQSPTGL-DGDQLVV-LTESPFRPHQRMSLSLPLINRAKKVAV 779

  Fly   194 VVTGAAKASVVKSV--FVDLDKKFPAAWVNPTKGQLTLIVD 232
            :|.|..|..:...|  .....||:|.:.|.|..|||...:|
Mouse   780 LVMGRTKREITTLVSRVGHEPKKWPISGVVPLSGQLVWYMD 820

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17333NP_572656.1 Glucosamine_iso 14..228 CDD:279517 77/229 (34%)
H6pdXP_006538521.1 PTZ00309 60..539 CDD:240353
pgl 591..826 CDD:273494 79/236 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0363
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.