DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17333 and h6pd

DIOPT Version :9

Sequence 1:NP_572656.1 Gene:CG17333 / 32013 FlyBaseID:FBgn0030239 Length:243 Species:Drosophila melanogaster
Sequence 2:XP_031760646.1 Gene:h6pd / 100127695 XenbaseID:XB-GENE-988586 Length:801 Species:Xenopus tropicalis


Alignment Length:239 Identity:75/239 - (31%)
Similarity:115/239 - (48%) Gaps:31/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EQLVQALGDLLQRCSQEALAKHDKFSVGLSGGS----LVQLLTKALKSCNLK-TAKWVFFFCDER 76
            |||::.|...:|..::.|:.....|.:.|||||    |.|.|:|.......| |..|:   .|||
 Frog   571 EQLIEKLARDIQLAAESAVQHSGVFHLALSGGSTPLALFQRLSKHHHGFPWKRTHLWL---VDER 632

  Fly    77 YVRLDDSDSTYGAYRAEWLTQ---LPCIQESQFVRADTSQPLDACAAD------YEAKVKSQVDR 132
            .|...:.||.:|... ::|.|   :|.|.... :..|.:|.:  |:.:      |..::.|.|..
 Frog   633 CVPFTEPDSNFGNIE-KYLLQHVRVPYINIHP-MPVDRNQRI--CSEEDLGTEVYAKEISSHVSN 693

  Fly   133 --FDLLLLGMGPDGHTCSLFPEQPATLQETKRLVIPIRNSPKPPPERITFTLPLINKARNVAFVV 195
              ||::|||:|.||||.|:||.....::..|  .:....||..|..|::.:|.||||||.:|.:|
 Frog   694 SSFDMVLLGLGNDGHTASIFPGAQDGIEGHK--FVLFTESPGKPHRRMSLSLSLINKAREIAVLV 756

  Fly   196 TGAAKASVVKSVFVDLDKKFPAAW----VNPTKGQLTLIVDAGA 235
            .|..|..::  ..:...::.|..|    ||||.|:|...:|..|
 Frog   757 LGKGKHDII--TLISRAERSPIKWPIFGVNPTFGKLVWYIDYDA 798

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17333NP_572656.1 Glucosamine_iso 14..228 CDD:279517 72/230 (31%)
h6pdXP_031760646.1 PTZ00309 38..518 CDD:240353
Glucosamine_iso 570..792 CDD:395940 73/231 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.