DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA4 and Antp

DIOPT Version :9

Sequence 1:NP_002132.3 Gene:HOXA4 / 3201 HGNCID:5105 Length:320 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:384 Identity:117/384 - (30%)
Similarity:135/384 - (35%) Gaps:163/384 - (42%)


- Green bases have known domain annotations that are detailed below.


Human    15 PKFPPFEEYAQHSGSG------------------------------GADGGPGGGPGYQQPP--- 46
            |:|||::....::|.|                              |..|.|......||.|   
  Fly    58 PRFPPYDRMPYYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQN 122

Human    47 --------APP---------TQHL--PLQQPQLP----------HAGG----------------- 65
                    ||.         ||.:  |.||.|.|          ..||                 
  Fly   123 QQQQQAQQAPQQLQQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMS 187

Human    66 GREPTASYYAPRTAREPAYPAAALYPAHGAADTAYP--------------YGYRGGASP-GRPPQ 115
            |....|....|   ....:|.|.|    |..|...|              |..:.|..| |.|||
  Fly   188 GHHMNAQMTLP---HHMGHPQAQL----GYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQ 245

Human   116 PEQPPAQAKGPAHGLHASHVLQPQLPPPLQPRAVPPAAPRRCEAAPATPGVPAGGSAPACPLLLA 180
            ...  .|.:||.. :|..|..| ..||...|.:             .:.|:|             
  Fly   246 GMM--HQGQGPPQ-MHQGHPGQ-HTPPSQNPNS-------------QSSGMP------------- 280

Human   181 DKSPLGLKGKEPVVYPWMKKIHVSAVNPSYNG--GEPKRSRTAYTRQQVLELEKEFHFNRYLTRR 243
              |||         ||||:         |..|  .|.||.|..|||.|.||||||||||||||||
  Fly   281 --SPL---------YPWMR---------SQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRR 325

Human   244 RRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTKMRSSNSASASAG----PPGKAQ 298
            |||||||.|||:|||:|||||||||||||::|   ||   ....|...|    ||...|
  Fly   326 RRIEIAHALCLTERQIKIWFQNRRMKWKKENK---TK---GEPGSGGEGDEITPPNSPQ 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA4NP_002132.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..77 22/136 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..168 18/81 (22%)
Antp-type hexapeptide 194..199 3/4 (75%)
Homeobox 218..271 CDD:278475 44/52 (85%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..320 8/30 (27%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 43/201 (21%)
Homeobox 301..354 CDD:395001 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.