DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA4 and unpg

DIOPT Version :9

Sequence 1:NP_002132.3 Gene:HOXA4 / 3201 HGNCID:5105 Length:320 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:426 Identity:101/426 - (23%)
Similarity:138/426 - (32%) Gaps:178/426 - (41%)


- Green bases have known domain annotations that are detailed below.


Human     3 MSSFLINSNYIEPKFPPFEEYAQHSGSGGA--DGGPGGGPGYQQP-----PAPPTQHLPLQ---- 56
            ::.|.:.:.::...|....|...|..:||.  ...|.|.|..|||     |.||..|.|..    
  Fly    79 LTQFPLYNPWLHGYFAQNHERLTHLIAGGCYLPSSPAGHPAAQQPQAQAQPQPPPPHPPTHALEK 143

Human    57 --QPQLPHAGGGREPTASYYAPRTAREPAYPAAALYPAHGAADTAYPY----------------- 102
              .|.|||      |..:.:.|..      ||||     |.|.|...|                 
  Fly   144 QLPPTLPH------PLDTRFLPFN------PAAA-----GVAPTDLSYRRLAELMNQDYVHSLSV 191

Human   103 --GYRGGASPGRPPQPEQPPAQAKGPAHGLHASHVLQPQLPPPLQPRAVPPAAPRRCEAAPATPG 165
              ..:..|:.||..:.:..|..|             |.|.|.|.|..:.|..:...   :|..|.
  Fly   192 HARLQHMAAAGRMHEDQANPGMA-------------QLQEPTPPQAHSSPAKSGSH---SPMEPA 240

Human   166 VPAG------GSAPACPLLLADKSPL-----------------------------------GLKG 189
            :..|      .|..:|..:....||.                                   |:.|
  Fly   241 LDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGG 305

Human   190 KEPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCL 254
            |:            |..|.|.:..:.:|.|||:|.:|:||||:|||..:||:...|.:||.:|.|
  Fly   306 KD------------SQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKL 358

Human   255 SERQVKIWFQNRRMKWKK------DHKL------------------------------------- 276
            ||.||||||||||.|||:      .|.|                                     
  Fly   359 SEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLS 423

Human   277 -PNTKMR----------------SSNSASASAGPPG 295
             |...:|                |:|::|.|.||.|
  Fly   424 GPKPDLRKKLSAEAIGGFEKFSGSTNASSPSGGPVG 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA4NP_002132.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..77 20/70 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..168 14/85 (16%)
Antp-type hexapeptide 194..199 0/4 (0%)
Homeobox 218..271 CDD:278475 32/52 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..320 11/77 (14%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/50 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.