DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Imp and Pcbp3

DIOPT Version :9

Sequence 1:NP_001245616.1 Gene:Imp / 32009 FlyBaseID:FBgn0285926 Length:638 Species:Drosophila melanogaster
Sequence 2:XP_006513979.1 Gene:Pcbp3 / 59093 MGIID:1890470 Length:394 Species:Mus musculus


Alignment Length:371 Identity:89/371 - (23%)
Similarity:150/371 - (40%) Gaps:89/371 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 GRQADFPLRILVQSEMVGAIIGRQGSTIRTITQQSRARVDVHRKENVGSL-EKSITIYGNPENCT 201
            |......:|:|:..:.||:|||::|.|::.:.::|.||:::    :.|:. |:.:||.|..:...
Mouse    41 GLNVTLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINI----SEGNCPERIVTITGPTDAIF 101

  Fly   202 NACKRILEVMQQEAISTNKGELSPECSE--ICLKILAHNNLIGRIIGKSGNTIKRIMQDTDTKIT 264
            .|...|....:::.|  |....||..|:  :.|:::...:..|.:|||.|:.||.|.:.|..::.
Mouse   102 KAFAMIAYKFEEDII--NSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQ 164

  Fly   265 VSSINDINSFNLERIITVKGLIENMSRAENQISTKLRQS-------------------------- 303
            |:  .|:...:.||.:|:.|..:.:.:...||...:.:|                          
Mouse   165 VA--GDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPKPASTPVIFAGGQVR 227

  Fly   304 ----------------------YENDLQAMAPQSLMFPGLHPMAMMSTPGNGMVF----NTSMPF 342
                                  |....|...|.......||.:||..||     |    .|:..|
Mouse   228 ADPLAASTANLSLLLQHPPLPAYTIQGQYAIPHPDQLTKLHQLAMQQTP-----FPPLGQTNPAF 287

  Fly   343 P----------SCQSFAMSKTPASVVPPVFPNDLQETTYLYIPNNAVGAIIGTRGSHIRSIMRFS 397
            |          ..|:.....:.....||.      .|..|.|||:.:|.|||.:|:.|..|.:.|
Mouse   288 PGEKLPLHSSEEAQNLMGQSSGLDASPPA------STHELTIPNDLIGCIIGRQGTKINEIRQMS 346

  Fly   398 NASLKIAPLDADKPLDQQTERKVTIVGTPEGQWKAQYMIFEKMREE 443
            .|.:|||     ...:..:||::||.|||.....|||:|..::..|
Mouse   347 GAQIKIA-----NATEGSSERQITITGTPANISLAQYLINARLTSE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpNP_001245616.1 RRM <37..>146 CDD:223796 1/7 (14%)
RRM2_VICKZ 42..118 CDD:240805
KH-I 145..208 CDD:238053 18/63 (29%)
KH-I 232..296 CDD:238053 16/63 (25%)
KH-I 369..436 CDD:238053 27/66 (41%)
KH-I 455..522 CDD:238053
Pcbp3XP_006513979.1 PCBP_like_KH 47..108 CDD:239089 18/64 (28%)
PCBP_like_KH 131..195 CDD:239089 17/65 (26%)
KH-I 318..380 CDD:238053 27/66 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831606
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.