DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Imp and PCBP3

DIOPT Version :9

Sequence 1:NP_001245616.1 Gene:Imp / 32009 FlyBaseID:FBgn0285926 Length:638 Species:Drosophila melanogaster
Sequence 2:XP_024307854.1 Gene:PCBP3 / 54039 HGNCID:8651 Length:596 Species:Homo sapiens


Alignment Length:477 Identity:109/477 - (22%)
Similarity:171/477 - (35%) Gaps:138/477 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 GRQGSTIRTITQQSRARVDVHRKENVGSLEKSITIYGN----PENCTNACKRILEVMQQEAISTN 219
            |..||....:..:|....|.|.|.:.....::....|:    |           .|:....:||.
Human    29 GLSGSISSCLNGESGHLSDTHIKPDRSQPHRAALFQGDAFWAP-----------SVLPHSTLSTL 82

  Fly   220 KGELSPE--------CSE------ICLKILAHNNLIGRIIGKSGNTIKRIMQDTDTKITVSSIND 270
            .....|:        .||      :.:::|.|...:|.||||.|.|:|::.:::..:|.:|..| 
Human    83 SHHPQPQFGRRMESKVSEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGN- 146

  Fly   271 INSFNLERIITVKGLIENMSRAENQISTKLRQSYENDLQAMAPQSLMFPGLHPMAMMSTPGNGMV 335
                ..|||:|:.|..:.:.:|...|:.|    :|.|                           :
Human   147 ----CPERIVTITGPTDAIFKAFAMIAYK----FEED---------------------------I 176

  Fly   336 FNTSMPFPSCQSFAMSKTPASVVPPVFPNDLQETTYLYIPNNAVGAIIGTRGSHIRSIMRFSNAS 400
            .|           :||.:||:..|||       |..|.:|.:..|::||..||.|:.|...:.|.
Human   177 IN-----------SMSNSPATSKPPV-------TLRLVVPASQCGSLIGKGGSKIKEIRESTGAQ 223

  Fly   401 LKIAPLDADKPLDQQTERKVTIVGTPEGQWKAQYMIFEKMREEGFMCGTDDVRLTVELLVASSQV 465
            :::    |...|...|||.|||.|||:...:....|...|.|......|...|..    .||:.|
Human   224 VQV----AGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPK----PASTPV 280

  Fly   466 GRIIGKGGQNVR--ELQRVTGSVIKLPEHALAPPSGGDEETPVHIIGLFYSVQSAQRRIRAMMLS 528
               |..||| ||  .|...|.::..|.:|...|..|         :|          .|:|.:..
Human   281 ---IFAGGQ-VRADPLAASTANLSLLLQHPPLPKLG---------VG----------SIKAELFP 322

  Fly   529 TNPPPITKKQKAAKEQLQQQQQSLAGAASSGSQQQQPQSPSQQQALP--------PQLHHQPVSS 585
            ::|             |....| |.....||..|.:...||..:...        ||::.:..||
Human   323 SHP-------------LNWPAQ-LCPPRGSGPTQSRDSMPSLTRMCNSSAGGRSYPQINGRCNSS 373

  Fly   586 ASSSSTPPAHHQQQASTAATSH 607
            |...|.|..:.:..:|....|:
Human   374 AGGRSYPQINGRCNSSAGGRSY 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpNP_001245616.1 RRM <37..>146 CDD:223796
RRM2_VICKZ 42..118 CDD:240805
KH-I 145..208 CDD:238053 9/52 (17%)
KH-I 232..296 CDD:238053 19/63 (30%)
KH-I 369..436 CDD:238053 22/66 (33%)
KH-I 455..522 CDD:238053 16/68 (24%)
PCBP3XP_024307854.1 PCBP_like_KH 108..169 CDD:239089 19/65 (29%)
PCBP_like_KH 192..256 CDD:239089 22/67 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141654
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.