DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Imp and T10E9.14

DIOPT Version :9

Sequence 1:NP_001245616.1 Gene:Imp / 32009 FlyBaseID:FBgn0285926 Length:638 Species:Drosophila melanogaster
Sequence 2:NP_001338807.1 Gene:T10E9.14 / 32928596 WormBaseID:WBGene00271694 Length:182 Species:Caenorhabditis elegans


Alignment Length:189 Identity:44/189 - (23%)
Similarity:87/189 - (46%) Gaps:30/189 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 DFPLRILVQSEMVGAIIGRQGSTIRTITQQSRARVDVHRKENVGSLEKSITIYGNPENCTNACKR 206
            ::|:...:.|.::|..||.:||.|..|.:.::..:|:.:.:...|   ::.|.|...|..:|...
 Worm     7 NYPIHRFLDSSLLGQFIGPEGSNIYKIEKYNKVALDIWKNDEENS---NVRITGPYWNLKSALND 68

  Fly   207 ILEVMQQEAIST--NKGELSPECSEICLKILAHNNLIGRIIGKSGNTIKRIMQDTDTKITVSSIN 269
            :||:     :||  ||.:.        .|....:..||.:|||:|..|..|...::..:.....|
 Worm    69 VLEL-----VSTIRNKNQR--------YKFEMPSKDIGFLIGKNGAKINEIKLSSNVDVHFERNN 120

  Fly   270 DINSFNLE---RI---ITVKG----LIENMSRAENQISTKLRQS-YENDLQAMAPQSLM 317
            : |..|.|   |:   :||.|    ::..:....:::::|.::: ||:.......:|||
 Worm   121 E-NRDNGETDGRVVVSVTVSGNYQQILIGLRLIYDRLTSKGQKTLYEDPRTRQFAESLM 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpNP_001245616.1 RRM <37..>146 CDD:223796 1/3 (33%)
RRM2_VICKZ 42..118 CDD:240805
KH-I 145..208 CDD:238053 14/62 (23%)
KH-I 232..296 CDD:238053 17/73 (23%)
KH-I 369..436 CDD:238053
KH-I 455..522 CDD:238053
T10E9.14NP_001338807.1 KH 14..73 CDD:197652 16/66 (24%)
KH_1 83..154 CDD:306517 17/71 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D286875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.